KEGG   Neisseria meningitidis FAM18 (serogroup C): NMC0555Help
Entry
NMC0555           CDS       T00458                                 

Definition
(GenBank) putative polyamine permease inner membrane protein
  KO
K11074  putrescine transport system permease protein
Organism
nmc  Neisseria meningitidis FAM18 (serogroup C)
Pathway
nmc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:nmc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NMC0555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nmc02000]
    NMC0555
Transporters [BR:nmc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter
    NMC0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 VirB3
Motif
Other DBs
NCBI-ProteinID: CAM09850
UniProt: A1KSM0
LinkDB All DBs
Position
585124..586011
Genome map
AA seq 295 aa AA seqDB search
MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGFSTKWYGALLENDTIL
EAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMISAPMVMPDVITGLSML
LLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVVIRSRLVELDQSLEEAAM
DLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSFLSGPGSSTLPQVIFSKIK
LGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRDREAAEAYRQEKLAAEKAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatccaaattatcttggttcttgaaactgatgttggcactgtcgctggcgttt
ctgtatatcccgctggttgttttggtcatctattcgtttaacgaatccaagctggtaacc
gtttggggcggcttttcgaccaagtggtacggcgcattgctggaaaacgacaccatcttg
gaagccgcttggctgtcgctgcggattgccgttgtgtcttcgcttgccgccgtcgttttg
ggcacgctggcaggctatgcgatggcgcggattaaacgttttcgcggcagtaccttgttc
gccggtatgatttccgcacctatggtgatgcccgacgtgattaccggtctgtctatgctg
ctgctgattattcaggtacagatatttttgcagggcagcgaatggttacaacatctctac
ttcgatcgtggctttttcactattttcttaggacatacgacgctgtgcatggcatacatt
accgttgttatccgttcgcgtctggttgagcttgaccaatcgctcgaagaagccgcaatg
gatttgggcgcgcgtccgctgaaaatcttttttgtcatcactttgcctttgattgcccct
gccatcgcttcaggctttctgctcggcattaccctgtctttggatgatttggtgattacc
tcattcctctccggccccggttcatccacattgccgcaggtgattttctccaaaatcaag
ctgggtcttgatccgcagatgaacgttttggcaaccatcctgatcggcatcatcggaaca
ttggtcatcatcgtcaattattggatgatgaggcaggcaaccaagcgtgaccgagaagcg
gcagaagcctaccgccaagaaaaattggctgccgagaaagcaaattaa

DBGET integrated database retrieval system