KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0405Help
Entry
NMBG2136_0405     CDS       T01929                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmd01100  Metabolic pathways
nmd01110  Biosynthesis of secondary metabolites
nmd01130  Biosynthesis of antibiotics
nmd01230  Biosynthesis of amino acids
Module
nmd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBG2136_0405 (aroB)
Enzymes [BR:nmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     NMBG2136_0405 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADY93141
LinkDB All DBs
Position
complement(421983..423062)
Genome map
AA seq 359 aa AA seqDB search
MKTLTVHTPSHSYPIFIGNGLLPQAGSLLKPHLGKRAAIIANETVAPLYLGTLQTALDAA
GVSHFSIILPDGEAHKNWQTLNLIFDGLMQNRAERKTTLIALGGGVIGDMVGFAAATYQR
GAPFVQIPTTLLSQVDSSVGGKTAINHPLGKNMIGAFYQPQAVLADLDTLHTLPARELSA
GMAEVIKYGALGDIGFFEWLEQHMPELMTLDREKLAQAVYRCCQMKADIVAQDETEQGIR
AWLNLGHTFGHAIETEMGYGTWLHGEAIAAGCVLAARLSEQLGKTSAADTARLAALLEAA
GLPSAPPVFAFEKWLEHMSHDKKVSGGIMRFIGLNRLGEANITEITDTDILRRTLQPYL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactgaccgtacacaccccgtcccacagctaccccatctttatcggcaacgga
ctgctgccgcaggcaggaagcctgctcaaaccgcatttgggcaaacgcgccgccatcatc
gccaacgaaaccgtcgccccgctctacctcggcacgcttcagacggcattggatgcggca
ggcgtatcccatttcagcatcatcctgcccgacggcgaggcgcacaaaaactggcagacg
ctcaacctcatctttgacgggctgatgcaaaaccgcgccgaacgcaaaaccacattaatc
gcactgggcggcggcgtgatcggcgacatggtcggctttgccgctgccacctaccagcgc
ggcgcaccgttcgttcaaataccgaccacgctgttgagtcaggtcgactcatcggtgggc
ggcaaaaccgccatcaaccacccgctcggcaaaaatatgattggcgcgttttaccagccg
caggcggtgcttgccgacttggacacgctgcacaccctgcccgcccgcgaattgtccgcc
ggtatggcggaagtcatcaaatacggcgcgctcggcgacatcggcttttttgaatggctg
gaacagcatatgcccgaactgatgacgctcgatcgggaaaaactcgcccaagccgtgtac
cgctgctgccaaatgaaggcagacatcgtcgcccaagacgaaaccgaacagggcatacgc
gcatggctcaacctcggacacaccttcggacacgccattgaaaccgagatgggttacggc
acttggctgcatggagaagccatcgccgccggctgcgtgttggcggcgcgtttgtccgaa
caactgggcaaaacctccgccgcagataccgcgcggctcgccgccctgctcgaagccgcc
ggactgccgtccgcgccacccgtgtttgcctttgaaaaatggctggaacacatgagccac
gataaaaaagtcagcggcggcatcatgcgctttatcggtctgaaccggctgggcgaagcc
aacatcaccgaaattaccgacacggacatcctccgccgcaccctgcaaccgtatctctga

DBGET integrated database retrieval system