KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0412Help
Entry
NMBG2136_0412     CDS       T01929                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00550  Peptidoglycan biosynthesis
nmd01100  Metabolic pathways
nmd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBG2136_0412
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMBG2136_0412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nmd01003]
    NMBG2136_0412
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmd01011]
    NMBG2136_0412
Enzymes [BR:nmd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NMBG2136_0412
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBG2136_0412
Glycosyltransferases [BR:nmd01003]
 Polysaccharide
  Bacterial polysaccharide
   NMBG2136_0412
Peptidoglycan biosynthesis and degradation proteins [BR:nmd01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NMBG2136_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ADY93148
LinkDB All DBs
Position
430024..432420
Genome map
AA seq 798 aa AA seqDB search
MIKKILTTCFGLVFGFCVFGVGLVAIAILVTYPKLPSLDSLQHYQPKMPLTIYSADGEVI
GMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDVWGVARAAVGNVVSGSVQSGA
STITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSLSKDKILELYFNQIYLGQRAYGFAS
AAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQ
QRDQALNEELHYERFVQKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKV
ATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTK
KKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRWAVVQEPL
LQGALVSLDAKTGAVRALVGGYDFHSKTFNRAVQAMRQPGSTFKPFVYSAALSKGMTAST
VVNDAPISLPGKGPNGSVWTPKNSDGRYSGYITLRQALTASKNMVSIRILMSIGVGYAQQ
YIRRFGFRSSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRDGRLR
AQMQPLEAGQNAPQAIDPRNAYIMYKIMQDVVRVGTARGAAALGRTDIAGKTGTTNDNKD
AWFVGFNPDVVTAVYIGFDKPKSMGRVGYGGTIAVPVWVDYMRFALKGKQGKGMKMPEGV
VSSNGEYYMKERMVTDPGLTLDNSGIAPQPSRRAKEDDGGAAEGGRQAADDEVRQDMQET
PVLPSNTGSKQQQLDSLF
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagattttaacgacttgttttggtttggtttttgggttttgtgtatttgga
gtgggtttggttgccattgctattttggtaacgtatccgaaactgccgtctttggattct
ttgcagcattaccagcctaaaatgccgttgactatttattcggcggatggggaagtcatc
ggtatgtatggggagcagcggcgcgaatttacaaaaatcggcgatttcccagaggtgttg
cggaatgcggttatcgccgccgaggataaacgcttttaccggcattggggggtggatgtt
tggggtgttgcccgcgctgccgtcggcaatgtcgtgtccggcagcgtgcagtcgggtgcg
agtacgattacgcagcaggtggcgaaaaatttttatttgagcagtgaaaaaacgttcaca
cgcaaattcaatgaggtgttgcttgcctataaaatcgagcagtctttaagcaaagacaaa
atcctcgagttgtatttcaatcagatttacctcggtcagcgcgcctatggttttgcatct
gccgcgcaaatctatttcaataagaatgtccgagatttgactttggcggaagccgccatg
cttgcgggactgcccaaggctccgtctgcctataatccgattgttaatccggaacgtgcc
aagttgcgccagaagtatattttgaacaatatgctcgaggagaagatgattaccgtgcaa
cagcgcgatcaggcgttgaatgaggaactgcattacgagcggtttgttcagaaaatcgat
cagagtgctttatatgtggcggaaatggtgcgtcaggaactgtatgagaaatacggtgaa
gatgcctatacgcagggttttaaggtttataccacggtccgcgctgatcatcagaaggtg
gcaaccgaggcattgcgcaaggctctacggaatttcgatcgcggcagcagctaccgcggt
gcggaaaactatatcgatttgagtaagagtgaagatgtcgaggagactgtcagccagtat
ctgtcgggactctataccgtcgataaaatggttcccgccgttgtgttggatgtgactaaa
aagaaaaatgtcgtcatacagctgcccggcggcaggcgggttacgcttgacaggcgcgcc
ttgggttttgcggcccgcgcggtcaataatgaaaaaatgggggaggaccgtatccgcagg
ggcgcggtcatccgtgtcaaaaacaacggcgggcgttgggcggtggttcaagagccgttg
ctgcagggggctttggtttcgctggatgcaaaaaccggagctgtgcgcgcgctggtcggc
ggttatgattttcacagcaaaacattcaatcgtgccgttcaggcaatgcggcagccgggt
tcgacctttaagccgtttgtctattcggcggcattatctaaggggatgaccgcgtccaca
gtggttaacgatgcgccgatttccctgccggggaaagggccgaacggttcggtttggaca
cctaaaaattcagacggcagatattccggctacattactttgagacaggctctgacggct
tccaagaatatggtttccatccgtattttgatgtctatcggtgtcggttacgcgcaacag
tatatccggcgtttcggcttcaggtcgtccgagctgccggcaagcctgtctatggcttta
ggtacgggcgagacaacgccgttgaaagtggcggaggcatatagcgtatttgcgaacggc
ggatatagggtttcttcgcacgtaatcgataagatttatgacagagacggcaggttgcgc
gcccaaatgcaacctttggaggccgggcaaaatgcgcctcaggcaatcgatccgcgcaat
gcctatattatgtataagattatgcaggatgtggtccgtgtcggtacggcaaggggggca
gctgcgttgggaagaacggatattgccggtaaaacgggtacgaccaatgacaataaggat
gcgtggtttgtcggttttaaccctgatgtggttactgccgtatatatcggcttcgacaaa
cctaagagtatggggcgtgtcggctacggcggtacgattgcggtgccggtttgggtggac
tatatgcgttttgcgttgaaaggaaagcagggcaaggggatgaaaatgcctgaaggtgtg
gtcagcagcaatggcgaatactatatgaaggaacgtatggtaaccgatccgggcttgacg
ctggacaacagcggtattgcgccgcaaccttcccgacgggcaaaagaagatgacgggggc
gcggcagaaggcggacggcaggcggcggatgacgaagtccgccaagatatgcaggaaacg
ccggtgcttccgagtaatactggttccaaacagcagcagttggattctctgttttaa

DBGET integrated database retrieval system