KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0551Help
Entry
NMBG2136_0551     CDS       T01929                                 

Definition
(GenBank) putrescine ABC transporter, permease protein PotI
  KO
K11074  putrescine transport system permease protein
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NMBG2136_0551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nmd02000]
    NMBG2136_0551
Transporters [BR:nmd02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter
    NMBG2136_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 VirB3
Motif
Other DBs
NCBI-ProteinID: ADY93282
LinkDB All DBs
Position
587936..588823
Genome map
AA seq 295 aa AA seqDB search
MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGFSTKWYGALLENDTIL
EAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMISAPMVMPDVITGLSML
LLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVVIRSRLVELDQSLEEAAM
DLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSFLSGPGSSTLPQVIFSKIK
LGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRDREAAEAYRQEKLAAEKAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatccaaattatcttggttcttgaaactgatgttggcactgtcgctggcgttt
ctgtatatcccgctggttgttttggtcatctattcgtttaacgaatccaagctggtaacc
gtttggggcggcttttcgaccaagtggtacggcgcattgctggaaaacgacaccatcttg
gaagccgcttggctgtcgctgcggattgccgttgtgtcttcgcttgccgccgtcgttttg
ggcacgctggcgggctatgcgatggcgcgtatcaaacgttttcgcggcagcacgctgttt
gccggtatgatttccgcgcctatggtgatgcccgacgtgattaccggcctgtctatgctg
ctgctgattattcaggtgcagatatttttgcagggcagcgaatggttacaacatctctac
ttcgatcgtggctttttcactattttcttaggacatacgacgctgtgcatggcatacatt
accgttgttatccgttcgcgtctggttgagcttgaccaatcgctcgaagaagccgcaatg
gatttgggcgcgcgtccgctgaaaatcttttttgtcatcactttgcctttgattgcccct
gccatcgcttcaggctttctgctcggcattaccctgtctttggatgatttggtgattacc
tcattcctctccggccccggttcatccacattgccgcaggtgattttctccaaaatcaag
ttgggtctcgatccgcagatgaacgttttggcaaccatcctaatcggcatcatcggaaca
ttggtcatcatcgtcaattattggatgatgaggcaggcaaccaagcgtgaccgagaagcg
gcagaagcctaccgccaagaaaaattggctgccgagaaagcaaattaa

DBGET integrated database retrieval system