KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_0552Help
Entry
NMBG2136_0552     CDS       T01929                                 

Gene name
puuB
Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00330  Arginine and proline metabolism
nmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NMBG2136_0552 (puuB)
Enzymes [BR:nmd01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     NMBG2136_0552 (puuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 FAD_binding_3 Thi4 HI0933_like FAD_oxidored Pyr_redox_2 Pyr_redox_3 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ADY93283
LinkDB All DBs
Position
588949..590244
Genome map
AA seq 431 aa AA seqDB search
MIRPDFQEYLPSYYFSSVNPHTVYPKLQCRLKTDTCIIGGGLSGLCTALPLAEQGHETVV
LEAARIGFGASGRSGGQVISDYACGMEEIEKQVGLEQAQWFWQQSLQAIELVDERVRKHT
IDCDWQRGYATVAVRPQHWEELQQWHEHAQRHYGASHYQLWDNTELKQQLDSDMYQGAQF
DPLSGHLHPLNYTLGIARAAAEAGTKIFEHSPMIRIEPYQNGWLVYTPEGSVECKNLVYA
VNTYAGLNPIFRPLERKAIAVSTFIIATEPLGARAKGLIRNNMAVCDNRHILDYYRLSAD
GRLLFGGKDNEFIDNPARMTELVRQDMLKVFPQLADVKIEYSWGGECDITANLVPHFGRL
APNVFYTQGYSGHGMAITGIAGLAVAEAILGDECRLKPFERLRQPNIILQPFLRKLGSFL
GSKYYQWKDSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcgccctgattttcaagaatatctgccttcttattatttcagttcggttaatcct
catactgtttatccgaaacttcaatgccgtctgaaaaccgatacctgtatcatcggcggc
ggattgagtggtttgtgcactgcattgcccttggcggagcagggacatgaaacggttgtg
ttggaagccgcgcgtatcggtttcggcgcgtcgggacggagtggcgggcaggttatcagc
gattacgcctgcggtatggaggaaattgaaaaacaggtcggtttggaacaggcgcaatgg
ttttggcaacagtctttgcaggcgatcgaactggtggacgaacgcgtccgcaaacatacc
atcgattgcgattggcagcgcggttatgccacggttgccgtccgtccgcagcattgggaa
gaattgcaacaatggcatgaacacgcccaacggcattacggtgcgagtcattatcaactc
tgggataacactgaactgaagcagcagcttgacagcgatatgtaccaaggcgcacagttc
gatcccttgtccgggcatctccatccgctcaattacacgttgggcatcgcccgcgccgct
gccgaagctggtacgaagatttttgagcattctcccatgatacgcattgaaccttatcaa
aacggttggctggtttacacccccgaaggcagcgtcgaatgcaaaaatctggtgtacgcc
gtcaatacttatgccggtttgaatccgatattccggcctttggaacgcaaggcgattgct
gtcagcacctttattattgccacagaacccttgggcgcgcgtgcaaaagggcttatccgc
aacaatatggcagtatgcgacaaccgccatattttggattattaccgcctcagcgcggac
ggcagactgcttttcggcggtaaggataacgagtttatcgacaatcccgcgcgtatgacc
gagcttgtccgccaagatatgcttaaagtttttccgcagcttgccgatgtcaaaatcgaa
tattcgtggggcggggagtgcgacattaccgccaaccttgtcccgcatttcggacgttta
gccccgaatgttttttatacgcaaggttattccggacacgggatggcgataacaggcatt
gcaggtctggcggttgccgaagcaattttaggggacgaatgccgtctgaagccgtttgag
cggttgcgccagccgaatattatcctgcaaccgtttttgcgcaaactcggttctttcctc
ggctcgaaatattatcagtggaaagacagccgttaa

DBGET integrated database retrieval system