KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1295Help
Entry
NMBG2136_1295     CDS       T01929                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Brite
Enzymes [BR:nmd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NMBG2136_1295 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ADY93995
LinkDB All DBs
Structure
PDB: 

Position
1335180..1335740
Genome map
AA seq 186 aa AA seqDB search
MNMKTLLALAVSAVCSVGVAQAHEHNTIPKGASIEVKVQQLDPVNGNKDVGTVTITESNY
GLVFTPDLQGLSEGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDD
AHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRM
ACGVIK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaaaccttattagcactagcggttagtgcagtatgttcagttggtgttgcg
caagcacacgagcataatacgatacctaaaggtgcttctattgaagtgaaagtgcaacaa
cttgatccagtaaacggtaacaaagatgtgggtacagtgactattactgaatctaactat
ggtcttgtgtttacccctgatttacaaggattaagcgaaggcttacatggtttccacatc
catgaaaacccaagctgtgagccaaaagaaaaagaaggtaaattgacagctggtttaggc
gcaggcggtcactgggatcctaaaggtgcaaaacaacatggttacccatggcaagatgat
gcacacttaggtgatttacctgcattaactgtattgcatgatggcacagcaacaaatcct
gttttagcaccacgtcttaaacatttagatgatgttcgcggtcactctattatgatccac
acgggtggtgataatcactccgatcatccagctccacttggcggtggcggcccacgtatg
gcatgtggcgtgattaaataa

DBGET integrated database retrieval system