KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1689Help
Entry
NMBG2136_1689     CDS       T01929                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Pathway
nmd00550  Peptidoglycan biosynthesis
nmd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBG2136_1689
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMBG2136_1689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmd01011]
    NMBG2136_1689
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nmd03036]
    NMBG2136_1689
Enzymes [BR:nmd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBG2136_1689
Peptidoglycan biosynthesis and degradation proteins [BR:nmd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NMBG2136_1689
Chromosome and associated proteins [BR:nmd03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    NMBG2136_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ADY94360
LinkDB All DBs
Position
complement(1802924..1804669)
Genome map
AA seq 581 aa AA seqDB search
MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQ
GDNRIVRTQTLPATRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELVDV
PVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIG
FTDIDGKGQEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLD
QRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNR
AVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQ
KSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSF
GYGLQLSLLQLARAYTALTHDGVLLPVSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEP
GGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA
HGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgttgattaagagcgaatataagcctcggatgctgcccaaagaagagcaggtcaaaaag
ccgatgaccagtaacggacggatcagcttcgtcctgatggcaatagcggtcttgtttgcc
ggtctgattgctcgcggactgtatctgcagacggtaacgtataactttttgaaagaacag
ggcgacaaccggattgtgcggactcaaacattgccggctacacgcggtacggtttcggac
cggaacggtgcggttttggcgttgagtgcgccgacggagtccctgtttgccgtgcctaaa
gagatgaaggaaatgccgtctgccgcacaattggaacgcctgtccgagcttgtcgatgtg
ccggttgatgttttgaggaacaagctcgaacagaaaggcaagtcgtttatctggattaag
cggcagctcgatcccaaggttgccgaagaggtcaaagccttgggtttggaaaactttgta
tttgaaaaagaattaaaacgccattacccgatgggcaacctgtttgcacacgtcatcgga
tttaccgatattgacggcaaaggtcaggaaggtttggaactttcgcttgaagacagcctg
catggcgaagacggcgcggaagtcgttttgcgggaccggcagggcaatattgtggacagc
ttggactccccgcgcaataaagccccgaaaaacggcaaagacatcatcctttccctcgat
cagaggattcagaccttggcctatgaagagttgaacaaggcggtcgaataccatcaggca
aaagccggaacggtggtggttttggatgcccgcacgggggaaatcctcgccttggccaat
acgcccgcctacgatcccaacaggcccggccgggcagacagcgaacagcggcgcaaccgt
gccgtaaccgatatgatcgaacccggttcggcaatcaaaccgtttgtgattgcgaaggca
ttggatgcgggcaaaaccgatttgaacgaacggctgaatacgcagccttataaaatcgga
ccgtctcccgtgcgcgatacccatgtttacccctctttggatgtgcgcggcatcatgcag
aaatcgtccaacgtcggcacaagcaaactgtctgcgcgtttcggtgccgaagaaatgtat
gacttctatcatgagttgggcatcggtgtgcgtatgcactcgggctttccgggcgaaact
gcaggtttgttgagaaattggcgcaggtggcggcctatcgaacaggcgacgatgtctttc
ggttacggcctgcaattgagcctgctgcaattggcgcgcgcctataccgcactgacgcac
gacggcgttttgctgccggtcagctttgaaaaacaggcggttgcgccgcaaggcaaacgc
atattcaaagaatcgaccgcgcgcgaggtacgcaatctgatggtttccgtaaccgagccg
ggcggcaccggtacggcgggtgcggtggacggtttcgatgtcggcgcgaaaaccggcacg
gcgcgcaagttcgtcaacgggcgttatgccgacaacaaacacatcgctacctttatcggt
tttgcccccgccaaaaacccccgtgtgattgtggcggtaaccattgacgaaccgactgcc
cacggttattacggcggcgtagtggcagggccgcccttcaaaaaaattatgggcggcagc
ctgaacatcttgggcatttccccgaccaagccactgaccgccgcagccgtcaaaacaccg
tcttaa

DBGET integrated database retrieval system