KEGG   Neisseria meningitidis G2136 (serogroup B): NMBG2136_1892Help
Entry
NMBG2136_1892     CDS       T01929                                 

Definition
(GenBank) chaperonin HslO
  KO
K04083  molecular chaperone Hsp33
Organism
nmd  Neisseria meningitidis G2136 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nmd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nmd03110]
    NMBG2136_1892
Chaperones and folding catalysts [BR:nmd03110]
 Heat shock proteins
  HSP33
   NMBG2136_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ADY94545
LinkDB All DBs
Position
complement(2028389..2029297)
Genome map
AA seq 302 aa AA seqDB search
MNQTAINRADVRTRFIFDDMPVRGLHVRLENVWQHIVKQKNYPAAIRRALGELLAAGVLL
SGNLKNEGTLIVQVQGRGRLKMLVAEAASDRTVRATARWDETAEIADDESLGDLLGEGGV
FVLTLQPKDGEPWQGVVPLEGGGIAQMLANYMKRSEQIDTHIVLSASDEAAGGLLVQRLP
EAVLDEEAWEHVSTLARTLTADELAELDAQHVLYRLFHETPPRVFEPETFEFSCTCSRGK
VSDMLLMLGGEEVGGVVVEQGSIEVDCDFCHSKYVFDETDVNALFGEDVVGVAKGLPRHT
VQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaccgccatcaaccgcgccgatgtgcgtacccgctttatcttcgacgatatg
cccgtgcgcgggctgcacgtccgtctggaaaacgtgtggcagcacattgtaaaacagaaa
aactatcccgccgccatccgccgcgccttgggcgagctgttggctgccggtgttctgctg
tcgggcaacctcaaaaacgaaggcacgctgattgtgcaggttcaggggcgggggcggctg
aaaatgctggttgcggaagcggcttccgaccgtaccgtccgtgcaaccgcgcgttgggac
gaaaccgcagaaatagccgatgacgaaagcctcggcgaccttttgggcgagggcggcgta
ttcgtgctgacgctgcagcccaaagacggcgaaccctggcagggcgtagtgcctttggaa
ggcggcggtatcgcgcaaatgttggcgaactatatgaagcgttccgaacaaatcgatacg
cacatcgtcctgtctgcaagcgacgaagcggcgggcggtctgctggtgcagcgtctgcct
gaagcggtgttggatgaagaggcatgggaacacgtcagtacgctggcgcgtacactgacg
gcggacgagctggcagaattggatgcgcaacatgttttgtaccgcctgttccacgaaacg
ccgccgcgcgtgttcgagccggaaacgtttgaattttcatgcacctgttcgcgcggcaaa
gtcagcgatatgctgctgatgctgggcggggaagaagtcggcggcgtggtggtggaacaa
ggcagcatcgaagtcgattgcgatttctgccacagcaaatatgtgtttgacgaaaccgat
gtcaacgcgctgttcggggaggatgtggtcggcgttgccaaagggctgccccggcatacc
gtccaataa

DBGET integrated database retrieval system