KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0598Help
Entry
NMB0598           CDS       T00027                                 

Definition
(RefSeq) Maf-like protein
  KO
K06287  septum formation protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    NMB0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf RAP
Motif
Other DBs
NCBI-GeneID: 902713
NCBI-ProteinID: NP_273642
UniProt: Q9K0J8
LinkDB All DBs
Position
complement(630177..630785)
Genome map
AA seq 202 aa AA seqDB search
MNTLYLGSNSPRRMEILTQLGYRVIQLPAGIDESVKAGETPFAYVQRMAEEKNRTALTLF
CETNGTMPDFPLITADTCVVSDGIILGKPRSQAEAIEFLNRLSGKQHTVLTAVCIHYRGK
TSSRVQTNRVVFKPLSSEEISAYVQSGEPMDKAGAYAVQGIGGIFIQSIEGSFSGIMGLP
VYETVSMLQDLGYRSPLSALKP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgaataccctctatttaggttcaaacagcccgcgccgaatggaaatcctgacacagttg
ggctaccgcgtcatccaactgcctgccggcatcgacgaatccgttaaagccggcgaaaca
cctttcgcttacgttcaaaggatggcagaagaaaaaaaccgaaccgccctgaccctcttt
tgcgaaaccaacggcacaatgcccgatttccccctgattaccgccgacacctgcgtcgtt
tcagacggcatcatattgggcaaaccccgctcccaagccgaagcaatcgaatttttaaac
cgattgtccggcaaacaacataccgtcctgactgctgtctgcattcattatcgcggcaaa
acgtcaagccgcgtccaaaccaaccgcgtcgttttcaagcccctgagttcggaagaaatt
tccgcctatgtgcaaagcggcgagccgatggacaaagccggtgcctacgccgtacaaggc
ataggcggcatctttatccaatctatcgaaggcagcttcagcggcattatgggactgccc
gtttatgaaaccgtttcgatgttgcaggatttgggataccgctcccccttgtccgccctt
aaaccgtaa

DBGET integrated database retrieval system