KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0602Help
Entry
NMB0602           CDS       T00027                                 

Gene name
hitA
Definition
(RefSeq) HIT family hydrolase
  KO
K02503  histidine triad (HIT) family protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nme04147]
    NMB0602 (hitA)
Exosome [BR:nme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NMB0602 (hitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIT DcpS_C
Motif
Other DBs
NCBI-GeneID: 902716
NCBI-ProteinID: NP_273646
UniProt: Q9K0J5
LinkDB All DBs
Position
complement(632562..632885)
Genome map
AA seq 107 aa AA seqDB search
MDNCIFCKIAAKDIPAQTVYEDGEMVCFKDINPAAPVHLLLIPKVHFDSLAHAAPEHQML
LGKMMLKVPEIAKAAGLADGFKTLINTGKGGGQEVFHLHIHIMGTPV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggacaactgtattttctgcaaaatcgccgccaaagacattccggcgcaaaccgtctat
gaagacggcgaaatggtttgtttcaaagacatcaaccccgctgctccggttcatctgctg
ctgattcccaaagtccatttcgattcgttggcacacgccgcgcccgaacatcagatgctg
ctgggcaaaatgatgttgaaagttcccgaaatcgccaaagcggcaggactggcagacggc
ttcaaaaccctgatcaataccggaaaaggcggcggacaagaggtcttccacctgcatata
cacatcatgggtacacccgtataa

DBGET integrated database retrieval system