KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0955Help
Entry
NMB0955           CDS       T00027                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00020  Citrate cycle (TCA cycle)
nme00310  Lysine degradation
nme00380  Tryptophan metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Module
nme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMB0955 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMB0955 (sucA)
   00380 Tryptophan metabolism
    NMB0955 (sucA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NMB0955 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-GeneID: 903075
NCBI-ProteinID: NP_273993
UniProt: Q7DDJ9
LinkDB All DBs
Position
967665..970493
Genome map
AA seq 942 aa AA seqDB search
MMDEKLNFSYLFGSNAPYIEELYEAFLENPDAVDEKWKQYFTDLSKQPGTVAVDVAHTPI
RESFVTLAKKKIASAVAGGADEAMLKKQVSVLRLISAYRIQGVGAAQLDPLKRIPPRDIE
ALDPKFHGLSDADMALQFNMGEGDFANRGKLPLSQIISNLKQTYCGHIALEYIYIPNTEE
RRWVRNYFESVLSTPHYNADQKRRILKEMTAAETLERYLHTKYVGQKRFGVEGGESAIAG
LNYLIQNAGKDGVEEVIIGMAHRGRLNVLVNILGKKPGDLFAEFEGRAEIKLPSGDVKYH
MGFSSDIATPHGPMHVSLAFNPSHLEIVNPVVEGSARAKQKRLGENGRDKVLPVLIHGDS
AFIGLGVNQATFNLSKTRGYTTGGTVHIVINNQIGFTTSDIRDTRSTVHCTDIAKMVSAP
VIHVNGDDPERVCFAIQAALDYRKKFHKDIVIDVVCYRKWGHNEGDDPTLTQPMMYKKVS
QHPGARALYTEQLIAEGVVTQAEADGYIQAYRDALDKGEHVEQTTLSNFQRTQIDWSKYQ
GKDWREHIETGLPAADIERLTEKFTAVPEGFALHPTAKRVIEARKAMASGKQAIDWGMAE
TLAYASLVTKGHGVRISGEDSGRGTFSHRHAVLHDQKREKWDDGTYVPLRHMGEGMGEFL
VIDSILNEEAVMAFEYGFACSAPDKLTIWEAQFGDFANGAQVTIDQFLSSGETKWGRLCG
LTTILPHGYDGQGPEHSSARVERWLQLCSENNMQVIMPSEASQMFHLLQRQVLGSYRKPL
VIFMSKRLLRFKGAMSPLENFTEGSTFRPVIGDTAERASNDSVKRVVLCAGQVYYDLEAG
RAERKLEDDVAIVRVEQLYPFPYDEVKAELAKYPNAKSVVWAQEEPKNQGAFYQIRHRIE
DVISEEQKLSYAGRPSSASPAVGYSSKHIAQLKQLVEDALAL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgaaaaactcaatttctcttacctgttcggttcaaacgcaccttacattgag
gaattgtacgaggcttttttggaaaaccccgatgcggttgatgaaaaatggaagcagtat
ttcaccgatttgagcaaacagccggggacggttgctgtcgatgtcgcacacacaccgatt
cgcgaatcatttgttactttggcgaaaaagaaaattgcatctgccgttgcgggcggtgcg
gatgaggcaatgctgaaaaagcaagtcagcgttttacggctgatttccgcctatcgtatc
caaggcgtgggtgcagcccaacttgatccgctcaaacgtatccccccgcgcgatattgaa
gccctcgatccgaaattccacggtctgtcagatgccgatatggcgcttcaattcaatatg
ggcgagggcgattttgccaatcgcggcaaactgcctttgtcccaaatcatcagcaacctc
aaacaaacctactgcggccacatcgcattggaatatatctatattcccaataccgaagag
cgccgctgggtacgcaattattttgaaagcgtattgtccacaccgcattacaatgccgat
caaaaacgccgtatcttgaaagagatgactgctgccgagactttggaacgttatctgcat
accaaatatgtcggtcagaaacgtttcggtgtcgaaggcggcgaaagcgcgattgccggt
ttgaactacctgattcaaaacgccggtaaagacggtgtggaagaggtcatcatcggtatg
gcgcaccgtggccgtctgaatgttttggtgaacattttgggcaaaaaacccggcgatttg
tttgccgaatttgaaggtcgtgccgaaatcaaactgcccagcggcgacgtgaaataccat
atgggcttcagctccgatattgccacgccgcacggcccgatgcacgtttctttggcgttc
aacccgtcacacttggaaatcgtcaacccggtggtggaaggttctgcgcgcgccaaacaa
aaacgtttgggcgaaaacggccgcgacaaagtcttgccggtattgattcacggcgactcc
gcatttatcggtctgggagtcaaccaagcgacattcaacctgtctaaaacgcgcggttat
accaccggcggtacggttcatatcgtcatcaacaaccaaatcggctttaccacttccgat
atccgcgatacccgttcaaccgtacactgtaccgatatcgcaaaaatggtttccgccccg
gttatccatgtgaacggcgatgatcccgaacgcgtttgctttgctatccaagccgctttg
gattaccgcaaaaaattccataaagacatcgtgattgacgttgtctgctaccgtaaatgg
ggtcacaacgagggcgatgatccgaccttgacccaaccgatgatgtacaaaaaagtatcg
caacaccccggtgcgcgtgctttgtacaccgagcaactgattgccgaaggcgtggtaacc
caagccgaggctgacggttacatccaagcttaccgtgatgctttggacaaaggcgagcac
gtcgagcaaacaacgttgagcaacttccaacgcacgcaaatcgactggagcaaataccaa
ggcaaagattggcgcgaacacatcgaaaccggtttgcctgccgcagatattgaacgtctc
actgagaagtttaccgccgtaccggaaggctttgccctgcatccgactgcaaaacgtgtg
attgaagcgcgtaaagccatggcatccggcaaacaggccatagattggggtatggccgaa
accttggcatacgccagcctcgtaaccaaaggtcacggcgtgcgtatttccggcgaggac
tcgggacgcggcacgttctcgcaccgccacgccgtattgcacgatcaaaaacgcgaaaaa
tgggacgacggtacttatgttcctctgcgccatatgggcgaaggcatgggcgagttcctg
gttatcgactccattttgaacgaagaagccgtgatggcgttcgagtacggctttgcctgc
tccgcacctgacaaactgaccatttgggaagctcaattcggtgacttcgccaacggcgcg
caagtgactattgaccaattcctgtcttcaggcgaaaccaagtggggtcgtttgtgcggt
ctgactaccatcctgccgcacggctacgacggtcaaggccccgagcactcttctgcacgc
gtagaacgttggttgcaactgtgttctgagaacaatatgcaagtcattatgccgtctgaa
gcgtcgcaaatgttccacctcttgcaacgtcaagtcttgggttcataccgcaaaccgctg
gtgattttcatgtccaaacgcctgttgcgcttcaaaggtgcaatgagcccgctggaaaac
ttcaccgaaggttcgaccttccgtccggttatcggcgataccgcagaacgcgcaagcaac
gacagcgtgaaacgcgtggtattgtgtgccggtcaggtttactatgacttggaagccggc
cgtgccgagcgtaaactggaagatgatgttgctattgtccgcgttgagcagctgtatccg
ttcccatatgacgaggttaaagctgaactggcgaaatatccgaacgcaaaatctgtggtt
tgggcacaagaagagccgaaaaaccaaggcgcgttctaccaaatccgccaccgcatcgaa
gatgttattagcgaagagcaaaaactgtcttatgccggtcgtccaagcagcgcatcgcct
gcagtgggctactcaagcaaacacattgctcaattgaaacaattggttgaagacgctttg
gcattgtaa

DBGET integrated database retrieval system