KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1358Help
Entry
NMB1358           CDS       T00027                                 

Gene name
gatB
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00970  Aminoacyl-tRNA biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMB1358 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nme03029]
    NMB1358 (gatB)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NMB1358 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NMB1358 (gatB)
Mitochondrial biogenesis [BR:nme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMB1358 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3580 HTH_Tnp_Mu_2
Motif
Other DBs
NCBI-GeneID: 903780
NCBI-ProteinID: NP_274376
UniProt: Q9JYZ7
LinkDB All DBs
Position
1380714..1382144
Genome map
AA seq 476 aa AA seqDB search
MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAI
KLGLALDAKINQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDVKTINVTR
AHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLVTWLD
ICDGNMAEGSFRVDANVSVRPKGQEEFGTRREIKNLNSFRFLEQAINYEAEAQIEILEDG
GKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDAQMQKAKAEMPELPKE
MAARFVADYGVSEYDARLLTASRAQAAYFEEAAKESGQGKLTANWMNGELAAALNKEGME
LADSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEATIAEIIEKHGLQQMTDTGE
IEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELIKAKLA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggaaaccgtaatcggcttggaaatccacgtccaattgaacaccaaatccaaa
atcttcagcggcgcatcgaccgcattcggcgcagaacccaacgcgcacgccagcgtagtg
gaatgcgcgctgccgggcgttttgcctgtgatgaaccgtgaagtcgttgaaaaagccatc
aaattgggtttggctttagatgcgaaaatcaatcagaaaaacgtgttcgaccgcaaaaac
tacttctatcccgacttaccaaaaggttatcaaatcagccagttggacttaccgattgtc
gaacacggcaaattggaaatcgtagtcggcgacgatgtgaaaaccatcaacgtaacccgt
gcgcacatggaagaagacgcaggcaagtccgtgcatgaaggcttgaacggcgcaaccggt
atcgacctgaaccgcgccggcacgccgctgttggaagtggtatccgaacctgaaatgcgt
tccgccgccgaagccgttgcctacgccaaggccttgcacagcttggtaacctggctggac
atttgcgacggcaatatggcggaaggctcgttccgcgtcgatgccaacgtatccgtgcgc
ccgaaaggtcaagaagagttcggcacgcgccgcgagattaaaaacctcaattccttccgt
ttcttggagcaggcgattaattacgaagcggaagcgcaaatcgagattttggaagacggc
ggcaaagtacagcaggcaaccatgctgtttgatcccgaaaaaggcgaaacccgcgtaatg
cgcctgaaagaagatgcgcacgactaccgctacttccccgaccctgatttgctgcccgtt
atcatttcagacgcccaaatgcaaaaagccaaagcagaaatgcccgagctgccgaaagaa
atggcagcgcgtttcgtggcggattacggcgtgtccgaatacgacgcgcgcctgctgacc
gcaagccgtgcgcaggctgcctattttgaagaagccgccaaagaaagcggacaaggcaag
ctgactgccaactggatgaacggcgaacttgccgccgcgctgaacaaagaaggcatggaa
cttgccgacagcccgattaccgccccgcgcctcgccgcgctggttggcaaaatcgccgac
ggcacattaagcagcaagttagcgaaaaaagcctttgaagccatgtgggcagaacccgaa
gccaccattgccgaaatcattgaaaaacacggtttgcaacagatgaccgacaccggcgag
attgaagccatggtggacgaagtgctggcaaacaacgccaaagccgtggaacagtttaaa
tccggcaacgaaaaagccctgaatgcgattgtgggacaagtgatgaaggccagcaaaggc
aaagccaaccccgcgcaggttcaagagctgattaaagccaaactggcttaa

DBGET integrated database retrieval system