KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1976
Entry
NMB1976           CDS       T00027                                 

Gene name
lysA
Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00300  Lysine biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01230  Biosynthesis of amino acids
Module
nme_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NMB1976 (lysA)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     NMB1976 (lysA)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Other DBs
NCBI-ProteinID: AAF42304
UniProt: Q9JXM2
LinkDB
Position
complement(2074556..2075800)
AA seq 414 aa
MTLFCEQVPYPRLAEAFGTPLYVYSQSALTEAFEHYQTAFAALNPLVCYAVKANGNLSII
KHFASLGSGFDIVSGGELARVLAAGGDAAKTIFSGVGKSEAEIEFALNAGVKCFNMESIP
EIDRIQKVAARLGKTAPVSLRINPDVDAKTHPYISTGLKANKFGIAYADALEAYHYAAQQ
PNLKIIGIDCHIGSQLTDLSPLVEACERILILVDALAAEGIVLEHLDLGGGVGIVYQDEN
VPDLGAYAQAVQKLIGTRRLKLILEPGRSLVGNAGSLLTRVEFVKYGEEKNFVMVDAAMN
DLMRPALYDAYHHIEAVETKDIATLTANIVGPICETGDFLGKDRTIACEEGDLLLIRSAG
AYGASMASNYNARNRAAEVLVDGNEYRLIRRRETLEQQMANELACLQAEHQNAV
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaccctattttgcgaacaagtcccctacccccgccttgctgaagcattcggcacaccg
ctttatgtgtacagccaatccgcgctgaccgaagcatttgaacactaccaaaccgcgttt
gccgctttgaacccgctcgtctgttacgccgtcaaggcaaacggcaatctgagcattatc
aaacacttcgcctcgctgggcagcggttttgacattgtgtccggcggcgaattggcacgc
gttttggcggcaggcggcgacgcggcaaaaaccatattttcaggcgtaggcaaaagcgag
gcggaaatcgagttcgcgctgaatgcaggcgtgaaatgcttcaatatggaaagcatcccc
gaaatcgaccgtattcagaaagttgccgcacgtttgggtaaaaccgcgcccgtctccctg
cgcatcaaccccgatgtcgatgcaaaaacccatccctacatctccacaggtctgaaagcc
aacaaattcggcatcgcctacgccgacgcgctcgaagcctaccactatgccgcacaacag
cccaatttgaaaatcatcggcatcgactgccacatcggttcgcaactgaccgacttaagc
ccgctggtcgaagcctgcgagcgcattttgattttggttgacgcgcttgccgccgaaggc
attgttttggaacatttagacttaggcggcggcgtcggcattgtttaccaagacgaaaat
gtgcctgatttgggcgcgtatgcccaagccgttcaaaaactgatcggcacacgccgtctg
aaactcattcttgagcccggccgcagcctggtcggcaacgcaggttcgctgctgacacgc
gtcgagtttgtcaaatacggcgaagagaaaaactttgtgatggtcgatgcggcgatgaac
gatttgatgcgcccggcgctttatgatgcctatcatcacatcgaggcggtcgaaaccaaa
gacatcgcgacgctgaccgccaacatcgtcggtccgatttgcgaaaccggcgacttcctc
ggcaaagaccgcaccatcgcctgcgaagaaggggatttgctgcttatccgcagcgcgggc
gcatacggggccagtatggcgagcaattacaacgcgcgcaaccgtgcggcagaggtgttg
gtggacggcaacgaataccgactcatccgccggcgcgaaaccttggaacagcaaatggca
aacgaactcgcctgcctgcaagccgaacatcaaaatgccgtctga

DBGET integrated database retrieval system