KEGG   Numida meleagris (helmeted guineafowl): 110387213
Entry
110387213         CDS       T06015                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110387213 (TGFA)
   04012 ErbB signaling pathway
    110387213 (TGFA)
SSDB
Motif
Pfam: DUF1180 DAG1
Other DBs
NCBI-GeneID: 110387213
NCBI-ProteinID: XP_021230774
LinkDB
Position
21
AA seq 156 aa
MPGEAAALALGMLVAVCHALENTTSALSDPPVAAAVRSHFNECPDSHRQFCFHGTCRFLV
QEDKPACVCHSGYVGTRCEHADLLAVVAANQKKQTITALLVVAVVASAVLIAACVLVHCC
RLRKRCGCCRAPLCGQEKPSGLLKGGASCCHAESVV
NT seq 471 nt   +upstreamnt  +downstreamnt
atgccgggagaggcggccgcgctggcgttgggcatgctggtggctgtgtgccatgccctg
gagaacacgacgtcagcgctgagcgatccccccgtggcagcggccgtgcggtcacacttc
aatgagtgccccgactcccaccgacagttctgcttccatgggacgtgccgcttcctggtg
caggaggacaagccggcgtgcgtgtgccactcgggttacgtggggacacgctgtgagcac
gccgacctgctggccgtggtggccgccaaccagaagaagcagacgatcaccgcgctgctg
gtggtggccgtggtggcctcggcggtgctcatcgccgcctgcgtgctcgtccactgctgc
cggctgcggaagcgctgcgggtgctgccgggcgccgctgtgcgggcaggagaaaccatcg
gggctgctgaagggcggagcgtcctgctgccatgctgagagcgttgtctga

DBGET integrated database retrieval system