KEGG   Numida meleagris (helmeted guineafowl): 110388091
Entry
110388091         CDS       T06015                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04012  ErbB signaling pathway
nmel04068  FoxO signaling pathway
nmel04110  Cell cycle
nmel04115  p53 signaling pathway
nmel04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110388091 (CDKN1A)
   04068 FoxO signaling pathway
    110388091 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110388091 (CDKN1A)
   04115 p53 signaling pathway
    110388091 (CDKN1A)
   04218 Cellular senescence
    110388091 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110388091
NCBI-ProteinID: XP_021232625
LinkDB
Position
25
AA seq 151 aa
MPLSQSRAGPVPCSSKACRSLFGPVDHEQLQNDFKELLRQQLEEAQRRWNFDFETETPLE
GRFKWERVPLAEQPSRELCALAKATGGGDGRSSAPRRVPPKGAVSGARHGASQQSSELTR
AASPQHLKRGQPTVKDFYSSKRRVVHDKPKL
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgctgtcgcagagcagggccgggccggtgccgtgcagcagcaaagcgtgcaggagc
ctctttggccccgtggaccacgagcagctccagaacgacttcaaggagctgctgaggcag
cagctggaggaagctcagcggcgctggaacttcgacttcgagaccgagacgcccctggaa
gggcgcttcaagtgggagcgggtcccgctggccgagcagccttcccgcgagctctgcgcc
ctggccaaggccaccggcggcggtgacggcaggagctcagcgccccgcagggtccccccc
aagggcgctgtcagcggggctcgccatggggcgtcgcagcagagctcggagctcaccagg
gccgcttctccgcagcacttgaaacgtgggcagcccactgtcaaagacttctacagctcc
aagaggagagttgtccatgacaagcccaagctgtga

DBGET integrated database retrieval system