KEGG   Numida meleagris (helmeted guineafowl): 110388615
Entry
110388615         CDS       T06015                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04068  FoxO signaling pathway
nmel04217  Necroptosis
nmel04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110388615 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110388615 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110388615 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nmel03000]
    110388615 (STAT3)
Transcription factors [BR:nmel03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110388615 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 E2R135 YojJ Syntaxin-6_N
Other DBs
NCBI-GeneID: 110388615
NCBI-ProteinID: XP_021233741
LinkDB
Position
26
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGSAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTQECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagcttccccatggagctgcggcagttcctggccccatggattgagagc
caggactgggcatacgctgccaacaaggagtcacacgccacactggtgttccacaaccta
ctgggggagatcgaccagcagtacagccgcttcctgcaggaatccaacgtcttgtaccag
cacaacctgcggcgcatcaagcaattcctgcagagcagatatttggagaagccgatggaa
atagcccgcatcgtggctcgctgcctgtgggaagagtcacggctcctccagacagctgcc
accgctgcccagcaagggggacaggcgacacatccaacagcagctgtagtgacagaaaag
cagcagatgctggagcagcatctgcaggatgtaaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaatcagtcagtgacacgtcagaaaatg
cagcagctggaacagatgctcacggcactggaccagatgcgaaggagtattgtgagcgag
ctggcaggactgctgtcagccatggagtatgtgcagaagatgctggcagatgaggagttg
gcagactggaagagacggcaacaaattgcctgcattggtggcccaccaaatatctgctta
gaccggcttgagaactggataacttctcttgccgaatcacagctgcagacccggcagcag
atcaagaagctggaagagctgcagcagaaggtgtcgtacaagggtgacccaattgtccaa
caccggccaatgctggaggagcggattgtggagctgttcaggaacctgatgaaaagtgct
tttgttgtggaaaggcagccctgcatgcccatgcatcctgaccggcccctggtcatcaaa
actggtgtgcagttcaccaccaaagtcagattgttggtgaagtttccagagctgaactat
cagctgaaaatcaaagtctgcattgacaaggactctggtgacgttgcagcacttcggggg
tcccggaagtttaacatcctggggacgaacaccaaggtcatgaacatggaggagtcaaat
aatggcagcctttcagcagagttcaagcacctgacactgcgggaacagaggtgtggtaat
ggaggcagagccaactgcgatgcctcactgattgtgaccgaggagctgcatctcatcacc
tttgagacagaagtgtaccaccaggggctgaagattgacctggagacccactcactgcct
gtggtagtcatctcaaatatctgccagatgcctaatgcctgggcatccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcactaagccacccattgggacg
tgggaccaggtggcagaggtgctgagctggcagttctcctctaccacaaagcgtggtctc
agcatcgagcagctgacaactctggcagaaaaacttctagggccaggtgtgaactactct
ggttgtcagatcacctgggccaagttctgcaaggagaacatggctggcaaaggcttctcg
ttctgggtctggctagacaacatcattgacttggtgaaaaaatatatcctggcgctgtgg
aatgaagggtacatcatggggttcatcagcaaggagcgggagcgagccatcctgagcacc
aagcctccgggaaccttcctgctgcgcttcagcgagagcagcaaggagggtggcatcacc
ttcacgtgggtggagaaggacatcagtggaaagactcagatccagtctgtggaaccttac
accaaacagcagctgaacagcatgtcatttgcggaaatcatcatgggctacaaaatcatg
gatgccaccaacattctggtgtctcccctggtgtatctgtacccggacatcccaaaggag
gaggcatttgggaagtactgtcgctctgagagccaggaacactcagaagctactgactca
ggtagtgctgctccatatctaaagaccaagttcatctgtgtcacccccacctccttcagc
aacaccatcgacctgcccatgtccccacgcaccctggactcactcatgcagtttggcaac
agtagtgagggagcagaggccaacgcaggaggccagtttgagtcgctgaccttcgacatg
gagctgacccaggagtgtgcatcttcaccgatgtga

DBGET integrated database retrieval system