Numida meleagris (helmeted guineafowl): 110392776 Help Entry 110392776         CDS       T06015                                  Symbol IFNG Name (RefSeq) interferon gamma isoform X1   KO K04687   interferon gamma Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel03050   Proteasome nmel04060   Cytokine-cytokine receptor interaction nmel04217   Necroptosis nmel04350   TGF-beta signaling pathway nmel05164   Influenza A nmel05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:nmel00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     110392776 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     110392776 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110392776 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110392776 (IFNG)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     110392776 (IFNG)    05168 Herpes simplex virus 1 infection     110392776 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:nmel03051]     110392776 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nmel04052]     110392776 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:nmel00536]     110392776 (IFNG) Proteasome [BR:nmel03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     110392776 (IFNG) Cytokines and neuropeptides [BR:nmel04052]  Cytokines   Interferons    110392776 (IFNG) Glycosaminoglycan binding proteins [BR:nmel00536]  Heparan sulfate / Heparin   Cytokines    110392776 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma EzrA DUF6364 Motif Other DBs NCBI-GeneID:  110392776 NCBI-ProteinID:  XP_021240789 LinkDB All DBs Position 1:complement(35468652..35482344) Genome browser AA seq 165 aa AA seqDB search MTCQTYNLFVLSVIMIYFGRTANSLNLAQLEDDIDKLKADFNSSHSDVADGGPIFIEKLK NWTGQSNEKKIILSQIVSMYLEMFENTDQSKPHIKHISEELCTLRDSLSDGVKKVKDIMD LAKLQMTDLRIQRKAANELFIVLQKLVDPPSLKRKRNQPQRRCNC NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgacttgccagacttacaacttgtttgttctgtctgtcatcatgatttattttggacgt actgcaaatagtctaaatcttgctcaacttgaagatgatatagacaaactgaaagctgac tttaactcaagtcattcagatgtagctgatggtggacctatttttatagagaaactgaag aactggacagggcagagtaatgaaaaaaagatcatactgagccagattgtttcaatgtac ttggaaatgtttgaaaacactgaccagtcaaagccgcacatcaagcacatatctgaggag ctctgtactctgagagacagcctttctgatggtgtgaagaaggtgaaagatatcatggac ctggcaaagcttcagatgactgacttgagaatccagcgcaaagctgcgaatgagctgttc atcgtcttacagaagctggtggatcctccgagtctcaaaaggaaaaggaaccagcctcag aggagatgcaattgctaa

DBGET integrated database retrieval system