KEGG   Numida meleagris (helmeted guineafowl): 110392930
Entry
110392930         CDS       T06015                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110392930 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110392930 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nmel04052]
    110392930 (KITLG)
Cytokines and growth factors [BR:nmel04052]
 Growth factors
  Growth factors (RTK binding)
   110392930 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 110392930
NCBI-ProteinID: XP_021241030
LinkDB
Position
1
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISEMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFIKENGHLYEEDHFIPENFFSLFNSTIEVYKEFADSLDKNDCIMPSTVETPENDS
RVAVTKTISFPPVAASSLRNDSIGSNTSSNKEALGFISSSSLQGISIALTSLLSLLIGFT
LGAIYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcagctactcctccttaat
cctcttgtcaaagcccagagttcctgcgggaatccggtgacagatgatgtaaatgacatt
gcaaaattggttggaaatctcccaaatgattatctgataacccttaaatatgtcccgaag
atggatagcctgcctaatcactgttggttgcatttgatggtgcctgaattttcgaggagt
ctacataatcttctccagaaattttcagatatttccgaaatgtctgatgttttaagcaac
tattcaatcattaataacctcacaaggataatcaatgatcttatggcatgtctagctttt
gataaaaataaggattttataaaagaaaacggtcacctttatgaagaagatcacttcatt
cctgagaatttttttagtctctttaatagtaccattgaggtctacaaggagtttgcagac
tcactggataagaatgactgcattatgccttcaactgtagaaacaccagagaatgattcc
agagtcgctgtcacaaaaacaatttcgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcagtaacactagcagtaacaaagaggcacttggcttcattagcagctcc
agcctgcaagggatcagcatagcattgacatcattgctgtctcttcttattggctttact
ttgggagccatatactggaagaaaacacatcctaaatccagaccagaaagtaatgaaact
acacagtgtcatggctgtcaagaggaaaatgagataagtatgttgcagcaaaaagagaaa
gaacatctacaagtgtag

DBGET integrated database retrieval system