KEGG   Numida meleagris (helmeted guineafowl): 110395457
Entry
110395457         CDS       T06015                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04020  Calcium signaling pathway
nmel04260  Cardiac muscle contraction
nmel04261  Adrenergic signaling in cardiomyocytes
nmel04270  Vascular smooth muscle contraction
nmel04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110395457 (CACNA1C)
   04020 Calcium signaling pathway
    110395457 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110395457 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110395457 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    110395457 (CACNA1C)
   04270 Vascular smooth muscle contraction
    110395457 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nmel04040]
    110395457 (CACNA1C)
Ion channels [BR:nmel04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110395457 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 110395457
NCBI-ProteinID: XP_021245545
LinkDB
Position
1
AA seq 2175 aa
MVNENKRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTASSTQRKRQQYGKQKKQGTTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGNSIGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYH
VQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTECKAGWEGPKHGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNRSTPAGLPDKKKEKFS
WFSHSTETHVSMPTSETESVNTDNVPGADIEGENCGARLAHRISKSKFSRYWRRWNRFCR
RKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLK
MYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYW
NSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQ
SLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKSITADGE
SPPATKINMDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAVPM
PDASAFFIFSPNNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVRHLSFRNQVLF
YFDIVFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVV
KILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGK
LYSCTDSSKQTEAECRGYYITYKDGEVNQPMIQPRSWENSKFDFDNVLTAMMALFTVSTF
EGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGE
QEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTI
CLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGS
IVDIAITEVNPAENTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFI
KSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCAT
GEAWQEIMLACLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAV
IMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLC
PHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWK
RTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQFA
VLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSY
YQSDGRSAFPQTFTTQRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALCRFPSPPSYPSTVSTVEGHGTPLSPTIRVQEAPWKLPSKRTHYYETLGRSSSRD
SQLAIVCQEEVSQDETYDENLNEDIEYCSEPSLLSTEMLSYQDDENRQLTPPENHKGEDT
RHSPKKGFLCSSALGRRASFHLECLKRQKNQGVDVSQKTVLPLQMVHHQALAVAGLSPLL
QRSHSPTTFSRLCATPPATPCSRGWPQQPIPTLRLEGAESSEKLNSSFPSVHCSSQFPDS
SDCGSPRRARPVSLTVPSQTAGSSRQFHGSASSLVEAVLISEGLMQFAQDPKFIEVTTQE
LADACDMTIEEMENAADNILNGNSKQSPNGNLLPFVNCRDAGQDSAGEEEEEVQNPDCGK
SQEELKDSRIYISSL
NT seq 6528 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacaagaggatgtacattcccgaggaaaaccatcaaggttccaactat
gggagtccccgtccagctcatgccaacatgaatgccaatgcagcggcagggcttgcccca
gagcatatccctacaccaggggcagctctgtcctggcaagctgcaattgatgctgccagg
caagccaaattgatgggtagtgctggcaatgcaacaatatccacagctagctccacgcag
agaaaacggcagcagtacgggaaacagaaaaaacagggtaccacgacagctacacgtcct
ccccgggcactgctgtgtttaacactgaaaaatcccatccggagggcatgcatcagcatc
gtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagctatctatatcccctttccagaagatgattccaatgccaccaattccaatctggaa
cgagtggaatatctctttctcataatttttacagtggaagcatttttaaaagtaatagca
tatggacttctctttcaccccaacgcttacctccgcaatggctggaatttactagatttt
ataattgtggtagtagggctttttagtgcaattttagaacaagcaaccaaagcagatggg
gggaattcaataggaggaaaaggtgccggattcgatgttaaagcactgcgggctttccga
gtattacgtcccttacgactggtgtctggagttcctagtctccaggtggttttaaattca
attatcaaggccatggtccctttgttgcatattgccctgctggtgctgtttgtcatcatt
atctatgccatcattggactggagttattcatgggaaagatgcataagacctgctaccat
gtgcaaggggggctgatagatacacctgcagaagatgacccgtctccctgtgccccccag
tccgcacatgggcggcagtgccagaatggaaccgagtgcaaggcaggctgggagggaccc
aagcatggcattacgaactttgataattttgcttttgccatgctgacagtgtttcagtgc
atcacgatggaggggtggacagatgtactctactgggtcaatgatgccataggaagggac
tggccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttg
gttctcggtgtacttagcggggaattttccaaggaacgagagaaggctaaggctcgggga
gatttccagaagttacgggaaaagcaacagctagaggaggatttgaagggatatttagac
tggataactcaagcagaagatattgaccctgaaaatgaagatgaaggcatggatgaggag
aagcctcgaaacagaagcactccagctggcttgcctgataagaagaaagaaaagttttct
tggtttagtcactccacagaaacccatgtgagcatgcccaccagtgagactgagtccgtg
aacacagacaacgtccctggagcagatattgaaggcgaaaactgcggtgctaggctagcg
catcgaatctccaaatctaaatttagtcgctattggcgccgatggaatcgattctgcaga
cgaaagtgccgtgctgctgtcaagtccaatgttttctactggttggtgatcttccttgtg
tttctcaacacccttaccattgcctctgaacactacaaccagccagactggcttactgag
gttcaagacactgccaataaggtgctgctagctcttttcacggcagagatgctgctgaag
atgtacagccttggtctccaggcctattttgtgtccctcttcaaccgctttgactgtttc
attgtgtgtggaggaatcctggaaacaattctggttgagacgaagatcatgtccccactg
ggcatttctgtgttgagatgtgttcggctattaagaatatttaaaatcacaagatattgg
aactccctgagtaacctagtggcttcactcctgaattcagtccgctccattgcctccctc
ctgctgctcctcttcctcttcatcatcatcttctctctgctggggatgcagctctttggg
ggcaagtttaactttgatgaaatgcagaccaggaggagtacatttgacaacttccctcag
tccctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatgtatgat
gggatcatggcttatggcggcccctcttttccaggaatgttggtctgtatttacttcatc
atcctcttcatctgtggaaactacatcctgctgaatgtatttttggccattgctgtggac
aaccttgctgatgcggagagtttaacatctgcacagaaagaggaggaagaggaaaaagaa
aggaaaaaactagctaggactgctagtcctgaaaagaaacaggagatagagaaaacagct
gtggaggaggagacaaaggaggagaaaattgagctgaaatcaatcactgctgatggagaa
tccccacctgctacaaagatcaatatggatgattatcaaccaaatgaaaatgaagaaaag
agcccatatcccacaacggaagcaccagcagaggaagatgaggaagaacctgagatgcct
gttggccctcggcctcgccccatgtctgagctgcacctcaaggaaaaggctgtgcccatg
cctgatgccagcgcttttttcatcttcagtcctaacaacaggtttcgtgtccactgccat
cgaatcgttaatgataacattttcaccaacctgatcctatttttcatcttgctcagcagc
atctccctggcagctgaggaccccgtccgacacctctcctttaggaaccaagttctcttt
tattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatgaccgca
tacggggctttcctccataagggctccttctgcagaaactatttcaacatcttagacctg
ctggtggtcagcgtttctctcatctcttttggaatccaatccagtgccatcaatgtggtg
aagatcttgcgtgttctgcgagtgcttagaccactgagggccatcaacagagccaaaggg
ctaaagcatgtggtccaatgtgtgtttgttgccatccgaaccatcggaaacattgtgatt
gtcaccactttgctgcagttcatgtttgcctgcattggagttcagttgtttaagggaaaa
ctctacagctgcactgatagctccaagcagactgaagcagaatgcagagggtactacatt
acatacaaggatggtgaggtcaatcagccaatgatccagccccggagctgggagaacagc
aagtttgacttcgacaatgtcttgactgccatgatggccctctttactgtctcaaccttc
gagggctggccagagttgctgtataggtccattgattcccacatggaggatgtgggaccc
atctataatcacagggttgagatctccatcttctttattatctacatcatcatcattgct
ttcttcatgatgaacatcttcgttggtttcgtcatcgtcacatttcaggaacaaggagaa
caagaatacaagaactgtgagctggacaagaaccagcgccagtgcgtagagtatgccctg
aaggcccgtcccctacggagatacatccctaaaaaccagtaccagtacaaagtttggtat
gtggtcaactccacctattttgaatacctgatgttcgttttgatcctgctgaacaccatc
tgtctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaacatcctc
aacatgctcttcactggcctcttcactgtcgagatggtcctgaagttaattgccttcaaa
cccaagcactatttctgtgatgcatggaatacatttgacgccttgattgttgtgggtagc
attgttgatatagcaatcaccgaggtgaacccagctgaaaatacccaatgctcttcctct
atgaacgcagaggaaaactctcgcatctcaatcaccttcttccgactcttccgcgtgatg
cgtctcgtgaagctcctgagccgaggggagggcatccggactctgctttggaccttcatc
aagtccttccaggctctcccctatgtggctcttctaatagtgatgctgttcttcatctac
gccgtgatcgggatgcaggtattcggtaaaattgcactgaacgataccacagaaatcaac
cgcaacaacaacttccagaccttcccccaagcggtgctgctgcttttcaggtgtgccacc
ggcgaggcctggcaggaaatcatgctggcgtgtctcccagacaagaagtgtgacccagag
tcagagccggccaactccaccgaagccgaccactcctgtggcagcagcttcgctgtcttc
tacttcatcagcttctacatgctctgtgccttcctgatcatcaatctttttgtagctgtt
ataatggataacttcgattacctgacacgggactggtccattttaggaccgcaccaccta
gatgagtttaaaaggatctgggcagagtatgaccctgaagccaagggacggatcaagcac
ttggacgtggtaacattgctccggcggattcagcctccactgggctttgggaagctttgt
cctcaccgagtggcttgcaaacgccttgtctccatgaatatgccactaaacagcgatgga
actgtgatgttcaatgccactctctttgcactggtcagaactgcgctgaggatcaagaca
gaaggtaacctggagcaagccaatgaagagcttagagcaataattaagaaaatctggaag
cgcaccagtatgaagctgctggaccaggtggtgcctcctgcaggtgatgatgaggtgact
gttgggaagttctacgccactttcctgattcaagagtatttccggaagttcaagaaacgc
aaagagcagggcctggtgggcaagccttcccagcgcaacgcactgtccttgcagtttgct
gttttgcaggctggtttgcgcacacttcacgacattggtccagagatccgacgagcaatc
tctggagacctgacagctgaagaagagctagataaggctatgaaagaagctgtttctgct
gcctctgaagatgatatcttccggagagccggaggcttgtttggaaaccatgtcagctat
taccaaagtgatggcaggagtgcattcccccagacattcaccacccagcgacctttgcac
atcaataagtctggcaacaaccagggagatactgaatctccatctcatgagaagttggtg
gactccaccttcactcccagcagctactcatcttcaggctccaatgcaaacatcaacaat
gccaacaacactgccctgtgccgcttcccaagcccacccagctaccccagcactgtcagc
acagtggaaggccacgggaccccattgtcacccaccatacgtgtgcaagaagctccctgg
aaactaccttccaaaaggacgcactactacgaaacattgggacgttccagttccagagac
agccagctggcaattgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaat
ttgaatgaagacattgagtactgtagtgaaccaagtctgctctctactgaaatgctctca
taccaagatgacgaaaacagacaactcactccaccagaaaaccacaaaggagaggacacc
cggcactctccaaagaaaggctttctgtgctcctcagcactaggtcgacgagcatctttt
cacttagagtgtctgaaaagacagaaaaaccagggcgtagatgtctcacagaagacagtt
ctgcctttacaaatggtacatcatcaggcattggcggtggctggcctgagcccccttctc
cagcgaagccattcccccaccacattctcccggctgtgcgccacgccgcccgctacaccc
tgcagccgaggctggccacagcagcccatcccgacgctgcgcctcgagggggctgagtcc
agcgagaagctcaacagcagcttcccctccgtgcactgcagctcccagttccccgacagc
tctgactgtggcagcccaaggagagccaggccggtgtccctcaccgtccccagccagaca
gcagggagcagcaggcagttccacggcagcgccagcagcttggtcgaagcggtgttgatt
tcggaaggactgatgcagtttgctcaagatccaaagttcattgaggtcacgacccaggaa
ctcgccgacgcctgcgacatgacgatagaagagatggaaaatgcagcagacaacattctc
aatggtaacagcaagcagagccccaatggcaacctgctgccttttgttaactgcagggac
gcagggcaggacagtgcaggcgaggaagaggaagaggtgcagaacccggattgtggaaaa
agtcaggaggagctgaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system