KEGG   Numida meleagris (helmeted guineafowl): 110395965
Entry
110395965         CDS       T06015                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00230  Purine metabolism
nmel01100  Metabolic pathways
nmel04020  Calcium signaling pathway
nmel04114  Oocyte meiosis
nmel04261  Adrenergic signaling in cardiomyocytes
nmel04270  Vascular smooth muscle contraction
nmel04371  Apelin signaling pathway
nmel04540  Gap junction
nmel04912  GnRH signaling pathway
nmel04914  Progesterone-mediated oocyte maturation
nmel04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    110395965 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110395965 (ADCY3)
   04020 Calcium signaling pathway
    110395965 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110395965 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110395965 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110395965 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    110395965 (ADCY3)
   04916 Melanogenesis
    110395965 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110395965 (ADCY3)
   04270 Vascular smooth muscle contraction
    110395965 (ADCY3)
Enzymes [BR:nmel01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     110395965 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1673
Other DBs
NCBI-GeneID: 110395965
NCBI-ProteinID: XP_021246758
LinkDB
Position
3
AA seq 1128 aa
MPRNRDFSEPEYSAEYSADYSVSLPSDPERAVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLLTCAAVYAADKLAPALAAGTGLAAHVL
LFALCKYRLLPERAARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGVHTLVLGVTVAQQRQDALDEGALLRQILSNIAIYLCAITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLVNTKERNGSVSMARTSPEEP
DEPDARVRGTLENGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFIVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTMADIVDMLSCQQDYSGTGNGTVVPPRPGGCWEQPKYYSYIAVLALVATIMLVQVSHMV
KLTLMVLITGAAGTVNIYAWEHIFDQYDRRRSQQSARSSLVPSKYSMTAMIFIVMLSFYY
FSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELY
SQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIK
TIGSTYMAASGVTPDANANGYSTKKETLSDKERWQHLADLADFALAMKVTLMNINYQSFN
NFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEY
GFRFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgccgaggaacagggatttctcggagcccgagtactcggccgagtactccgccgactac
tcggtgagcctgccgtcggaccccgagcgcgccgtgggccggacccacgaggtgacggtg
cgcagctcggggccgtgcctctgcctgccccgcttcatgcgcctcaccttcgcgcccgag
tccctggagaacctctaccagacctacttccgtcgccagcgccacgagaccctcctggtg
ctggtggtcttcgccgccctcttcgattgctacgtcctcctcacgtgcgccgcggtctac
gccgccgacaagttggccccggcgttggcggcggggaccgggttggccgcccacgtgttg
ctcttcgccctctgcaagtaccggctgctgcccgagcgcgccgcccgccgcttcctgccc
tatgtcctctgggtcctcatcttggcccagatcttctgctacttgggcctcaacttctcg
cgctcgcccgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctgcgcctggcgcccatcgtgctcatcaccgccgtgtcctgcggggtc
cacacgctggtgcttggcgtcaccgtcgcccaacagcggcaggatgccctggatgagggc
gcgctgctgagacagatcctgtccaacattgccatctacctttgtgccatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaagcacggcag
tcccttgaggtcaagctcaacctggaggagcagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcacgtggcggatgagatgctgaaagatatgaagaaggacccaagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctctttgcggacatcgtgggtttcactcagctctcctcgtcctgcagcgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagccaaataccaccag
ctgcgcatcaagatcctgggtgactgctattactgcatctgtgggctgcctgactaccgg
gaggaccacgctgtctgctccatcatgatggggcttgccatggtggaggccatttcctat
gtgcgggaaaagaccaagacggcggtggacatgcgtgtgggagtgcacagcggcacggtg
ctgggcggcgtgctgggccagaagcgctggcagtacgacgtgtggtccaccgacgtcact
gtggccaacaagatggaggcaggtggcatccctgggcgtgtgcacatctcacagagcacc
atggactgcttgaagggcgagttcgaggtggagccgggcgagggcggctctcgctgcgag
tacctgaaggagaagggcattgtcacctacctcatcgtagtgcccaagcagcctctacgc
aatggcatcaatggggtgaagctgtcactgacctcgtcccacggaggctccccactgctc
gtcaacaccaaggagcgcaatggcagtgtcagcatggcacgcaccagccctgaggagcct
gatgagcccgacgccagagtgaggggcactctggagaacggggaggaggatggagaggct
gtgaacccatccttccccaacccgcggcgccggctgcggctgcgggacctggctgagcgg
gtaattgatgcgtcgcagaatgagcaggagctcaacaagctgctcaacgaggccctgctg
gagcgcgagtccgtccaggcgttgaaggggaagagcaccttccggctctccatgcgcttc
attgaccccgagatggagacgcgctactcggtggagaaggagaagcagagcggtgctgcc
ttcagctgctcctgtgttgtcctcttcttcactgccttggtggaggtcttcatcgaccct
tggctggtggccaactacgtgaccttcatagtgggggagatcttgctgctcatcctcacc
ctctgctctctggctgccatctttccccgggtcttccccaaaaagcttgtggccttctcc
acctggattgacaggactcgctgggcacgcaacacctgggccatggccgccatcatcatt
gtcaccatggctgatattgtggacatgctcagctgccagcaggactacagtgggacaggc
aatgggacggtggtgccaccacggccgggtggctgctgggagcagcccaagtactacagc
tacatcgccgtgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgactctcatggtgctgatcaccggggcggccggcactgtcaacatctatgcctgg
gagcacatcttcgaccagtacgaccgccgccgcagccagcagagcgccaggtcctctctg
gtcccctccaagtattccatgacagccatgatcttcatcgtgatgctcagcttttactac
ttctctcgccacgtggaaaagctggccaggacactcttcctctggaagattgatgtccac
gaccagaaggagagggtctatgagatgcggcgctggaacgaggcccttgtcaccaacatg
ctgcccgagcacgtggcccggcacttcctgggctccaagaagcgggacgaggagctgtac
agccagtcctacgacgagattggcgtcatgttcgcttctctccccaactttgctgacttc
tacacagaggagagtatcaacaatggtggcatcgagtgcctgcggttcctcaatgagatc
atctctgacttcgacgcactcctggatgaaccccaattccggtgtatcaccaaaatcaaa
accatcggcagcacctacatggccgcgtccggagtgacccccgatgccaacgccaatggc
tacagcaccaagaaggagaccctctcggataaggagcgctggcagcatttggctgacctc
gccgactttgccttagccatgaaggtgacgctgatgaacatcaactaccagtccttcaac
aacttcatgctgcgcataggcatgaacaagggcgccgtgctggcaggagtcattggtgcc
cgcaagccccactatgacatctggggcaacacagtgaacgtggccagcaggatggagtcc
accggtgtgatggggaacatacaggtggtagaggagacccatctcatcctgaaggagtat
ggcttccgctttgtgcgccgtggggccatctacgtcaagggcaaaggggagctgctcact
ttctttctcaagggccgggagaagcagggctccttcgtcaatggctcatccgtcacccta
ccccatcaggtggtggacagctcctga

DBGET integrated database retrieval system