KEGG   Numida meleagris (helmeted guineafowl): 110397725
Entry
110397725         CDS       T06015                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X1
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04020  Calcium signaling pathway
nmel04144  Endocytosis
nmel04510  Focal adhesion
nmel04540  Gap junction
nmel04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110397725 (PDGFRA)
   04020 Calcium signaling pathway
    110397725 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110397725 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110397725 (PDGFRA)
   04540 Gap junction
    110397725 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110397725 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nmel01001]
    110397725 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nmel04090]
    110397725 (PDGFRA)
Enzymes [BR:nmel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110397725 (PDGFRA)
Protein kinases [BR:nmel01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110397725 (PDGFRA)
CD molecules [BR:nmel04090]
 Proteins
  110397725 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 110397725
NCBI-ProteinID: XP_021250107
LinkDB
Position
4
AA seq 1099 aa
MGTTRSLHLSLAMGNPPRTFLILGCFLTGPLLTLCQLPLPTIVPSRNEMVVQLNSNFTLK
CSGDSEVSWQYPVTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVED
GEVEGKDIYIYVPDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPV
YAFYDSKQGFIGNFLAGPYTCKTMVKGMEFRSDEFLIYILRATSQLPVEIEALKTVYKTG
ETIVVTCVVFDNEVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDY
ECTARHATKEVKENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMY
WLKDNVTLIENLTEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKRYTFS
LLIRVPALILDLVDDHQGSAGRQTVRCLAEGTPLPGVEWLVCKDIKKCSNDTSWTLLTNN
ISDIHMEAHLDEKNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVA
AAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEF
PRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIM
THLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKDLDIF
GMNPADESTRSYVILSFENTGEYMDMKQADATQYVPMLERKEGSKYSDIQRSVYDRPASY
KKKSLSESEVKNLLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQ
GKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEI
FSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSE
IVESLLPGEYKKSYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDE
QRLSADSGYIIPLPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDI
DMMDDIGIDSSDLVEDSFL
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggggaccactcggagtttgcatttgtcgctagctatgggtaatcccccaaggacgttc
ctgatcctgggctgttttctcacaggaccgctcctaacactttgccagcttcctctgccg
actattgttcccagtagaaatgagatggttgtacagctgaattccaatttcacactcaaa
tgctctggagacagcgaagtgagctggcagtacccggtgaccgagggaagccacaggata
gacatcagacatgaggagaacaacagtggcctcttcgtgacagtgctcgaagtcggaaat
gcctcagccgctcacacgggcatgtatgtttgctattataaccacacgcaagtggaggat
ggggaagttgaggggaaggacatctacatctatgtgcctgacccagacatgccttttgtt
ccttccttaccagaagaccagttcatcctagtagaagaaggtgatcccactgttatccct
tgtcggacaagtgacccaagtgctgaagtgactttagttaacagtttagacaagcctgtc
tatgctttctatgacagcaaacaaggcttcatagggaacttccttgcaggaccatacaca
tgcaaaacaatggttaaaggcatggagttcaggtccgatgagttcctcatctatatttta
agagctacttcacagctgccggttgaaattgaagctcttaaaactgtctacaaaacaggc
gagaccatcgtagtaacttgtgtggtctttgacaacgaggtggttaatttacagtggaat
tatcctgggaaagtgaaagaaaaaggtctgataaaacttgatgatatcaaagtcccatcg
cagaagctggtttacaccttgaccattcctgacgcatcagtgaaagacacaggggattat
gaatgtactgctcgacatgcaaccaaggaggttaaggaaaataagaaagtagtcattaca
gttcatgacaaagggttcattcatctagagcctcaatttagccctttggaagctgtcaat
ctacatgaagtcaaaaattttgtcgtcgatgtgcaggcgtaccccgctccaaaaatgtac
tggttgaaggataatgtgactctgattgaaaatcttactgagattgttactagttcaaac
agagtccaggaaacacggtttcaaagtatactaaaattgatccgggccaaggaagaagac
agtggatactatactttggttgctgaaaatgaagatgagattaaaagatacaccttctca
ttgctaatacgagttccagccttgatcttagatcttgtggacgaccaccaaggctctgct
ggcaggcagacagtgaggtgcttggctgaagggaccccgcttcctggtgtggaatggttg
gtttgcaaggacattaaaaaatgcagcaatgacacttcctggactcttctgactaacaac
atctctgatatacacatggaagcccacctggatgagaagaacatggtggaaagccaggtg
accttccagaaggtagaggaaaccctggctgtgagatgtgtagcaagaaacgaccttggt
gctgttactcgggaactgaaacttgtggctcccaccttacgatcagaactgacggtggct
gctgcagtcttagtactgttggtgattgtgataatttcactgattgtcctggtcatcatc
tggaaacagaagccaaggtatgagataagatggagagtcattgagtctatcagccctgat
ggccatgaatacatttatgtggacccaatgcaactaccttatgactccaggtgggagttt
cctcgagacggcttagtgctcggtcgaatccttggttctggtgcatttggaaaagtggtg
gaagggacagcatatggattaagtcgttcacaaccggtgatgaaagtagctgtgaaaatg
ctgaaacctacagctagatccagtgaaaaacaggcgctcatgtctgaactgaagataatg
acacaccttggtccccacctgaatattgtgaacctccttggagcttgtacaaaatcaggt
cctatttacataatcactgaatactgcttttatggtgatttggtgaactatctgcacaag
aacagggacagtttcctcagccgacatccagagaaaccaaagaaagatctggatattttt
gggatgaacccagctgatgaaagcacaagaagctatgtgattttatcgtttgaaaacact
ggagaatacatggacatgaaacaagctgatgcaactcagtatgtgccaatgctggaaaga
aaggagggatctaaatactctgatattcagagatctgtatatgatcgacctgcttcatac
aagaagaaatctttgtcagaatcagaagtaaaaaaccttctttcagatgacagttcggag
ggtctgagcctactggatttgctaagcttcacctaccaagttgcacggggaatggaattc
ttggcttctaaaaattgtgtacaccgtgacttggcagctcgtaatgtccttctggctcaa
ggcaaaatcgtgaagatctgcgactttgggttggctagagacatcatgcatgattccaac
tacgtctccaagggcagtactttccttccagtaaaatggatggcacctgaaagcattttt
gacaatctgtacacaacattaagtgatgtctggtcttatggtattctgctgtgggaaata
ttttctcttggtggcacaccatatcctggcatgatggtggactccactttctacaataag
ataaagagtggctaccgaatggcaaaacctgatcatgctaccaatgaagtgtatgaaatc
atggtaaagtgctggaacagcgaaccagagaaaagaccttctttttaccatttgagtgaa
attgtggagagcttgttgcctggagagtacaaaaagagctacgagaagattcacctggat
ttcctgaaaagtgatcacccagctgtcactcgcatgagaggggactgtgacaatgcttac
attggtgtcacctacaagaatgaagacaagttaaaggatagagagagcggatttgatgag
cagaggctgagtgctgacagtggatacatcatccccctgcctgacattgaccctgtttct
gaagatgagcttggcaaaaggaacaggcacagttcccagacatctgaagaaagtgccatt
gaaactggttccagtagctctacttttatcaagagggaggacgagaccattgaggacatt
gacatgatggatgacattgggattgactcctcggatctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system