KEGG   Numida meleagris (helmeted guineafowl): 110400907
Entry
110400907         CDS       T06015                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04068  FoxO signaling pathway
nmel04110  Cell cycle
nmel04115  p53 signaling pathway
nmel04218  Cellular senescence
nmel04310  Wnt signaling pathway
nmel04340  Hedgehog signaling pathway
nmel04371  Apelin signaling pathway
nmel04510  Focal adhesion
nmel04530  Tight junction
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110400907 (CCND1)
   04340 Hedgehog signaling pathway
    110400907 (CCND1)
   04371 Apelin signaling pathway
    110400907 (CCND1)
   04068 FoxO signaling pathway
    110400907 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110400907 (CCND1)
   04115 p53 signaling pathway
    110400907 (CCND1)
   04218 Cellular senescence
    110400907 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110400907 (CCND1)
   04530 Tight junction
    110400907 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110400907
NCBI-ProteinID: XP_021256923
LinkDB
Position
6
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLEEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggacgcc
aacctgctcaatgacagggtgctgcagaccatgctgaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtc
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattatttggacaggtttttgtcgttcgaacccctcaagaaaagccggttgcaa
ttgctcggagctacctgcatgtttgtggcttccaaaatgaaggaaacgattcctctgacc
gcggaaaagctgtgcatttacaccgacaactccatcagacccgacgagttactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggaagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system