KEGG   Numida meleagris (helmeted guineafowl): 110402713
Entry
110402713         CDS       T06015                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110402713 (CACNA1E)
   04020 Calcium signaling pathway
    110402713 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:nmel04040]
    110402713 (CACNA1E)
Ion channels [BR:nmel04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110402713 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 110402713
NCBI-ProteinID: XP_021260772
LinkDB
Position
7
AA seq 2402 aa
MLGLGTCSVSAPGRAAEPAASPHYALTLPEEEMWREHRLALMHSTQSCNLLEPQSLAEVL
VSRAASFDALCQPRDADGDSGSALDLGLGAYVPISPDVIKRRRGGLIEQRDIIKAHEAHK
MQSTPQARRKEWEMARFGEAVAGRLGSGDGGSEQNRSRQGAAAPAGGSPGTFKQTKAQRA
RTMALYNPIPVRQNCFTVNRSLFLFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLA
LEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIV
VLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLL
LFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGVQGCPPGYECREWIGPND
GITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVL
GVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSAL
EVLRRATIKRNRTDAMTRDSSDEHCVDISSVGERRLAQRRPLHPTLGNPLSRSGLKGVDG
ASYLRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPAWLTHFLYYAEFL
FLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISVLRAL
RLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGGFNFIDG
TPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIVLTLFGNYTL
LNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERERRRRH
HMSVWEQRTSQLRRHMQMSSQEGINKDEPPLINPHASIFRRKKPGDGVALEKCDEEQGGK
GERPPAEGPEQPAPGTNPGGGEDRRSPSPRARRDKEMWQHKACHGNCEPGEEGAGGGIEE
RARVRQSQRRSRHRKTRTEGKEPSGALESRAGSQEMGLEEPGPTEGTQDGEQRGDAATAL
DLIQGEPEASGDPSRTNGVPTEEGSLPASAPEPSRGMESSLGEQDCSSPDTSEQALLGGA
ALGASRTVSHSEPDLSSVTANTEKATESTTIMIDVQDSTVVQISNKTDGEASPLKEAESK
EDEEEMEKKKRKKEKSETGKAMVPHSSMFIFSTTNPVRRACHYIVNLRYFEMCILLVIAA
SSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNIL
DFIVVVGALVAFALATNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNV
FNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWK
RHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVV
FPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQY
RVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKI
IAFGFLNYFRDTWNIFDFITVIGSITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQ
GYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSF
LGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFF
CSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLT
LMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQ
QLDSELQKEILTIWPHLSQKMLDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQ
LEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTLTGLSSRSGFPSLSPLSPQEIFQL
ACMDPAHGQFQEHQSLEPEVREFQRVQPSNRGSYLPVDTQDHAVSGRASSMPRLTVDPQV
VTDTSSMRRSFSTIRDKRTNTSWLDEFSMERSSDNTYKSRRRSYHSSLQLSARRLNADSG
HRSEGHRSGGRERGRSKERKHLLSPDISRCNSEERSPQAHDESPERRRESRSPSEGRSQT
PNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYASMLRHAAGDASPPPEE
TEGGSPLLSKEPNAAGLTESSSSPAGKPSRPSTPQRYISEPYLALHDDSHASDCGEEETL
TFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGAGQGVMCGASIDVLSDTEEDD
KC
NT seq 7209 nt   +upstreamnt  +downstreamnt
atgctcggactcggcacgtgctccgtcagtgccccgggcagggcggctgagccggccgca
tccccccactacgctctgaccctgcccgaggaggagatgtggcgcgagcaccgacttgcc
ctgatgcacagcacccagtcctgcaacttgctggagccccagagcctggccgaggtgctg
gtctcacgcgccgccagcttcgatgccctctgccagccgcgggatgccgacggtgacagc
ggcagcgccttggacctggggctcggtgcctatgtccccatcagccccgatgtcatcaag
cgccgtcggggagggctgatcgagcagagggacatcatcaaggcacacgaggcacacaag
atgcagagcacgccgcaggcacggaggaaggagtgggagatggctcgctttggggaggcg
gtggccggcaggctgggctccggggatgggggctcggagcagaaccgcagccggcaagga
gccgctgctccggcaggagggtccccgggaaccttcaagcaaaccaaagcgcagagagcc
cggactatggctctgtacaaccccatccctgtccggcagaactgcttcaccgtcaacaga
tcgttgttcctctttggggaagataacatagtcaggaaatacgccaagaagctcatcgac
tggcctcccttcgagtacatgatcctggcaaccatcattgccaactgcatcgtgttggcc
ctggagcagcacctcccagaggatgacaagacgccaatgtcgcggagactggagaagacg
gagccgtacttcatcgggattttctgcttcgaggctgggattaagatcgtggctctgggc
ttcgttttccacaagggctcgtacttgcgcaatggctggaacgtcatggacttcatcgtg
gtcctcagtggcatcctcgccaccgccgggacacacttcaacacgcacgtggacctgcgc
actctgcgggccgtgcgcgtgctcaggcctctgaagctcgtctcaggcattcccagcctt
cagattgtgctcaaatccatcatgaaggccatggtgcctctcctccagatcggcttgctg
ctctttttcgctattctcatgtttgctatcatcggcctggagttctacagcgggaaactg
caccgagcctgctacacaaacaattcaggtgagctggaggaactggaccctccccacccc
tgcggggtgcagggttgtccgccgggctatgagtgccgggagtggatcggtcccaatgac
gggatcacgcagtttgacaacatcctctttgctgtgctgaccgtcttccagtgcatcacc
atggaagggtggaccacagttctgtacaataccaatgatgccttaggagccacctggaac
tggctgtacttcatccccctcatcatcattggatccttcttcgtcctcaaccttgtcctg
ggagtgctgtcaggggagtttgccaaagagcgtgagcgcgtggagaaccgccgggccttc
atgaagctgcggcgccagcagcagatcgagcgggagctcaacggctaccgggcctggata
gacaaagcggaggaagtcatgctggctgaagagaacaaaaatgctgggacctcagcctta
gaagtgctcaggcgagccaccatcaagaggaatcggacggatgccatgacccgtgactcc
agcgatgagcactgcgtcgatatctcctctgtgggcgagcggaggctggcacagaggagg
cctctccatcccaccttgggtaaccccctgagtcgctccggtcttaaaggagtggatgga
gcctcttatttaaggcacaaggagcggctcctgcgcatctccgttcgccacatggtgaaa
tcccaggtcttctactggattgtgttgagcctggtggctctaaacactgcctgcgtggcc
atcgtccatcacaaccagccagcctggctcacccacttcctctactatgcagagttcctg
tttcttgggctcttcctcctggagatgtccttgaagatgtatgggatggggccacgcttg
tacttccattcttcattcaactgcttcgactgtggggtcacagtgggaagcatcttcgaa
gtggtttgggccatcttccgaccagggacctcttttgggatcagtgtcctacgagccctt
cgtctcctgcgaatatttaaaataaccaagtactgggcatccttgaggaatttggtggtc
tcactgatgagctccatgaagtctataatcagcctgctcttcttgctcttcctcttcatt
gtagtcttcgctctgctgggaatgcagctgtttggaggcgggtttaacttcatcgatggg
acaccatcggccaactttgacactttccctgcagccatcatgacggtgttccagatcttg
acgggcgaggactggaacgaggtgatgtacaacggcatccgctcccagggaggcgttcgc
tcgggcatgtggtcctccatctatttcatcgtcctcaccttgtttgggaactatactctg
ctgaatgtcttcttggccattgctgtggacaacttggctaatgctcaggagctcaccaag
gatgagcaggaggaagaggaggcctttaaccagaagcacgcccttcagaaagccaaggaa
gtcagccccatgtctgcccccaacatgcctgctattgagcgggagcggcgccggcggcac
cacatgtcggtgtgggagcagcgcaccagccagctgcgccggcacatgcagatgtccagc
caggaaggcatcaacaaggatgagccgcccctcatcaacccccacgccagcatcttccgc
cgcaagaagccgggggacggcgtcgccttggagaagtgcgacgaggagcagggcggcaag
ggcgagcggccgccggctgagggtcccgagcagccggccccggggaccaacccgggcggt
ggggaggacaggaggagcccgtcgccccgtgccaggcgggacaaggagatgtggcaacac
aaagcgtgccatgggaactgtgagccgggcgaggaaggggcaggaggtggcatcgaggag
agggcacgggtgaggcagagccagcggcgcagccggcatcggaaaaccaggacagagggg
aaggagccgagcggagccctggagagccgtgcgggcagccaggagatggggctggaggag
cccggccccacagaggggacgcaggatggggagcagcgtggggatgctgccacagcgctg
gacctgattcagggcgagccggaggcgagcggggacccctccaggaccaatggggttccc
actgaggagggtagcctcccagcatcggcacctgagccctcccggggaatggagagtagc
ctaggcgagcaggactgcagcagcccggacaccagtgagcaggccctgcttgggggggca
gcactgggggccagccgcactgtcagccacagcgagccagacctgtcctctgtcaccgcc
aacaccgagaaggccaccgagagcaccaccatcatgatcgatgtccaagactccactgtg
gtacagattagcaacaagaccgacggagaagccagccccttgaaggaggcagagagcaaa
gaggatgaggaggagatggagaagaagaagcggaagaaggagaagagcgagacgggcaaa
gcgatggtgccacacagctccatgttcatcttcagcaccacaaacccggtgcgcagagcc
tgccactacattgtgaacctgcgctacttcgagatgtgcatcctcctggtcatcgccgcc
agcagcatcgccctcgcagctgaggatcccgtcctcaccaactccgaccgtaacaaagtg
ctgaggtattttgactacgttttcactggcgtcttcaccttcgagatggttatcaagatg
atcgaccagggcttgatcctgcaggatggctcctacttccgagacctctggaacatcctc
gatttcatcgtggtggtgggagcgctggtggctttcgccttggcgaccaacaagggccgg
gatatcaagaccatcaagtctctccgtgtgctgcgggtgttgaggcccctgaaaaccatc
aagcggctgccgaaactcaaggctgtcttcgactgcgttgtgacgtccctcaagaatgtc
ttcaacatcctcattgtctacaagctcttcatgttcatctttgctgtcattgccgtccag
ctcttcaaggggaagtttttctactgcactgacagctctaaggacacagagaaggactgc
atagggaactacgtggaccacgagaagaacaagatggaggtgaagtgccgggagtggaaa
cgacacgagtttcactatgacaatataatctgggcattgctcaccctgttcacagtctcc
actggcgagggttggccccaggtgctgcagcattcggtggatgtgacggaggaggaccgt
gggcccagccgcagtaaccgcatggagatgtccattttctacgttgtctattttgtggtc
ttccctttcttcttcgtcaacatttttgtggctctcatcatcatcacattccaagagcaa
ggagacaaaatgatggaggagtgcagtctggagaagaacgagagggcctgtattgacttt
gccatcagtgccaagcccctcacgcgctacatgccccagaaccggcacaccttccagtac
cgggtctggcactttgtggtctccccatcctttgagtataccatcatggccatgattgct
ttgaacactgtggtgctgatgatgaagtactactctgctccatacacctatgagctggcc
ctgaagtacctgaacatcgctttcaccatggtgttctctttggagtgcgtccttaagatc
attgctttcggcttcctgaattatttccgggacacctggaacatctttgacttcatcacc
gtcatcggcagcatcacggagatcatcctgacggacaccaagctggtgaacaccagcagc
ttcaacatgagcttcctgaagctcttccgggcggctcggctcatcaagctgctgcgccag
ggttacaccatccgcatcctgctgtggacgttcgtgcagtccttcaaggccctcccctat
gtctgcctcctgatcgcgatgcttttcttcatctatgccatcattgggatgcaggttttt
ggcaacatcaaactagatgaggaaagccacattaaccggcacaacaacttccgcagcttc
ctgggctccctcatgctccttttcaggagtgccaccggtgaggcatggcaggagatcatg
ctctcctgcttggagggcaagggctgcgagccggacacgacggcgacgtccgggcagaac
gagaacgagcgctgcggcaccgacctggcctacgtttacttcgtctccttcatcttcttc
tgctcgttcctgatgctcaacctgttcgtggcggtcatcatggacaattttgagtacctg
actcgagattcctccatcctgggacctcaccatctagatgagtttgtccggatctgggca
gagtatgacagagcagcgtgtggccgaatccattacactgagatgtatgaaatgctgact
cttatgtcaccaccgctaggcctcggcaagagatgtccttccaaagtggcctataagaga
ctggtgctgatgaacatgcccgtggccgaggacatgacggtccatttcacctccaccctg
atggcgctgatacgcaccgccctggacatcaaaattgccaaaggtggtgcagattggcag
cagttagactctgagcttcaaaaggagatcctgaccatttggcctcacctgtcccagaag
atgctcgacctgttggtacccatgccaaaaacctctgacctgactgttggcaaaatatat
gcagccatgatgatcatggattactacaagcagagcaaggccaagaagcagaggcagcag
ctggaggagcagaaaaacgcgcccatgttccagcgcatggagccatcctctttgccgcag
gaaatcatctcgaatgcaaaggctctgccttacctccagcaggacaccctcacggggctg
agcagccggagcgggttcccctcgctgagcccgctctcaccacaggagatcttccagctg
gcgtgcatggatccggcccacgggcagttccaggagcaccagtctctggagccagaggtt
agggagtttcaaagagtgcagccctctaaccgtggcagctaccttcccgtggacactcag
gaccacgctgtctctgggagggcctcctccatgcctcgtctcactgtggatccccaggtg
gtgacggacaccagctcgatgcggcggtcgttttccaccatccgagacaagcgcaccaac
acctcctggctggatgaattctccatggagcgcagcagcgacaacacctacaagtcccgc
cggcgcagctaccactcctcgctccagctctctgcccggcgcctcaacgctgactcaggc
cacaggtctgaggggcaccgctcgggcggcagggagcggggccgatccaaagagcgcaag
cacttgctgtcccctgacatctcccgctgcaactcagaggagaggagtccccaggctcac
gatgagtccccagagcggcgacgcgagtcccggtcccccagcgagggcaggtcgcaaacg
cccaacaggcagggaacgggttccctgagcgaaagctccatcccctccatctcggacacc
agcacaccccggcgaggccgccgccagctcccaccggtgcccccgaaaccgcgtcccctc
ctgtcctacgcctccatgctgcggcacgccgccggagacgcctcaccacctcccgaggag
accgagggggggtccccgctcctctccaaggagcccaacgccgccggcctgaccgagtct
tccagctccccagcggggaagccgagccggccgtccaccccgcagcgttacatctcggag
ccctacctggccctgcacgacgactcgcacgcctcggactgcggcgaggaggagacgctc
accttcgaggcggccgtggccaccagcctgggtcgttccaacaccatcggttcggccccg
ccgctgcgacacagctggcagatgcccaacgggcactaccggcggcggaggcgaggggcc
gggcagggagtgatgtgcggggccagcatcgacgtgctcagcgacaccgaggaagatgac
aagtgctag

DBGET integrated database retrieval system