KEGG   Numida meleagris (helmeted guineafowl): 110404213Help
Entry
110404213         CDS       T06015                                 

Definition
(RefSeq) cadherin-1-like isoform X1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04371  Apelin signaling pathway
nmel04514  Cell adhesion molecules (CAMs)
nmel04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110404213
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    110404213
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110404213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nmel03036]
    110404213
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:nmel04515]
    110404213
   04090 CD molecules [BR:nmel04090]
    110404213
Chromosome and associated proteins [BR:nmel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110404213
Cell adhesion molecules [BR:nmel04515]
 Cadherins
  Major cadherins
   110404213
CD molecules [BR:nmel04090]
 Proteins
  110404213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Transthyretin Cadherin_2
Motif
Other DBs
NCBI-GeneID: 110404213
NCBI-ProteinID: XP_021263954
LinkDB All DBs
Position
10
AA seq 375 aa AA seqDB search
MSPRAFTLLILLVQDAVLSARADVLTFPILPPISCLENHRGPYPMRLVQIKSNKDKESKV
YYSITGQGADSPPVGIFVIERETGWLKVTEQLDREKIDRYTLFSHAVSASGQPVEDPMEI
IITVMDQNDNKPMFIKEVFVGYIEENAKPGTSVMTVNATDADDAVNTDNGIVSYSIVSQQ
PPSPHPQMFTIDPARGIISVLGTGLDRETTPNYTLIVQATDQEGKGLSSTATAIIEVTDA
NNPSTDGILRTTKAGVKPEMPSGSLTTHVLNTATGLPAAGLALRLAQLGEPGGQWTELAQ
RWTDADGRCLPLLPPGQAEAGTYKLRFETAAYWQGLGYTSFYPFVEVVFTITDPAQKLHV
PLLISPYSYTTYRGS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccccgagccttcaccctcctcatcctcctcgtgcaggacgcggtgctgagcgct
cgggcagatgtgctgaccttccccatcctcccccccatcagctgcctcgagaaccaccgg
gggccctaccccatgaggctggtgcagatcaaatccaacaaggacaaggagtccaaggtg
tactacagcatcacggggcagggcgcggacagcccgcccgtgggcatcttcgtcatcgag
cgcgagacggggtggctgaaggtgaccgagcagctggaccgggagaagatcgatcgatac
accctcttctcccacgccgtgtcggccagcgggcagcccgtggaggaccccatggagatc
atcatcacagtgatggaccagaatgacaacaagcccatgttcatcaaggaggtcttcgtc
ggctacatcgaggagaacgcgaagccaggcacctccgtgatgaccgtgaacgccacggat
gcggacgacgcagtgaacacggacaacggcatcgtcagctactccatcgtcagccagcag
ccgcccagcccgcacccccagatgttcaccattgacccggccaggggcatcatcagcgtg
ctgggcacggggctggaccgggagaccactcccaactacacgctgatcgtccaggccacg
gaccaggagggcaagggcctgtccagcactgccacggccatcattgaggtcacggatgcc
aacaaccccagcaccgacggcatcctgaggaccaccaaggctggagtcaagcccgagatg
ccgagtggctccctgaccacccatgtgctgaacacggccacggggctgcccgctgccggc
ctcgcactgcgcctggcacagctgggggagccgggcgggcagtggacggagctggcacag
aggtggacggatgcggacgggcgctgcttgcccctcctgcccccagggcaggctgaggct
ggcacctataaactgcgctttgagacggcggcatactggcagggcctggggtacaccagc
ttctacccctttgtggaggtcgtcttcaccatcactgacccagcccagaagttgcacgtc
ccactgctgatcagcccctactcctacacaacgtaccggggcagttag

DBGET integrated database retrieval system