KEGG   Numida meleagris (helmeted guineafowl): 110404645
Entry
110404645         CDS       T06015                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
nmel  Numida meleagris (helmeted guineafowl)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 PHD C1_2
Other DBs
NCBI-GeneID: 110404645
NCBI-ProteinID: XP_021264757
LinkDB
Position
11
AA seq 341 aa
MELIELRELQPEPRPGRGRLERANALRISPARRHGSGARPEPRPAAAQGTGHRFEPRRRG
LHTWCDLCGDFVWGGGRKSLQCRHCSFTCHYRCRALVRLDCSGPPGTGDEDDGSEQELEK
DTNVDEPSSWETAELDPAQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLARPVS
VPAAKRGPGGRPGQRTAGVKRRTSFYLPRGTVKHLHVLSHTRASEVISALLRKFTVVDDP
RKFALFERSEKDEQVYLRKLADEEQPLRLRLLAGPSEKALSFVLKENESGEVNWDAFSLP
ELHNFLRILQREEDEQLRRVRHRYARCRRELQAALAAHTPG
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagctgatcgagctgcgggagctgcagcccgagccacggccgggccggggccgcctg
gagcgagccaacgcgctgcgcatcagcccggcccgccggcacggctccggggcgcggccc
gagcccaggccggcggcggcacagggcaccgggcaccgcttcgagccccggcgccgcggg
ctccacacctggtgcgacctctgcggggacttcgtctggggaggcggcaggaagagcctc
cagtgccgccactgcagcttcacctgccactatcgctgccgggccctggtgcggctggac
tgcagcggccccccaggcacaggggacgaggacgatggcagcgagcaggagctggagaag
gacacgaatgtggatgagcccagcagctgggagacagcggagctggacccagcacaggtg
gagcagcgcatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacaccggcttcatcaaagtacagctgaagctggcgcgccccgtctct
gtgccagctgccaagcggggtcctggggggcggccagggcagcgcacagcgggcgtgaag
cgccgcacatccttctacctgccccgtggcaccgtcaagcacctgcacgtgctctcacac
acccgtgccagcgaggtgatcagcgcactgctccgcaagttcaccgtggtggacgacccc
cgcaagttcgccctcttcgagaggtccgagaaggatgagcaagtgtacctgcgcaagctg
gcagacgaggagcagccgctgcggctgcggctgctggcaggccccagcgaaaaggcgctg
agcttcgtcctgaaggagaacgagagcggcgaggtgaactgggacgccttctcgctgccc
gagctgcacaacttcctgcgcatcctgcagcgtgaggaggacgagcagctgcgccgtgtc
cgccaccgctacgcccgctgccgccgggagctgcaggccgcgctggccgcccacacgccg
ggctga

DBGET integrated database retrieval system