KEGG   Numida meleagris (helmeted guineafowl): 110405326
Entry
110405326         CDS       T06015                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04060  Cytokine-cytokine receptor interaction
nmel04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110405326 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    110405326 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nmel04052]
    110405326 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:nmel00536]
    110405326 (IL4)
Cytokines and growth factors [BR:nmel04052]
 Cytokines
  Interleukins
   110405326 (IL4)
Glycosaminoglycan binding proteins [BR:nmel00536]
 Heparan sulfate / Haparin
  Cytokines
   110405326 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 110405326
NCBI-ProteinID: XP_021266216
LinkDB
Position
12
AA seq 140 aa
MSSSLPTLLLLLLLLAGHGAAHTLHSELSLPLQESIQMCTLLAKEASCEKMNVTDIFAGN
KSNNRLELLCEAATVVRDSQRCHWRLRGLFLNLCQLVNATSSHKAPCPVAAGNTTSMHKF
LEDLHRFLQQLAKENLSFSS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagctcctccctgcccaccctgctcctgctcctgctgctgctggctggccacggggct
gcacacacgctgcactcagagctgtcattgccactgcaggagagcatccagatgtgcact
ttgttggctaaagaggcttcctgtgagaagatgaacgtgacggatatctttgcaggcaac
aagtccaataacagacttgagctcctatgcgaagccgccacagttgttcgggacagccag
cgctgccactggagactgcggggcctcttcctcaacctgtgtcagctcgtgaatgctacc
agcagccacaaggcaccgtgtcctgtggcagcaggcaacactacttcaatgcataagttc
ctagaggacctacacagattcctccagcaactagcaaaagagaatttatcgttttcttct
taa

DBGET integrated database retrieval system