KEGG   Numida meleagris (helmeted guineafowl): 110405391
Entry
110405391         CDS       T06015                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110405391 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110405391 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nmel04052]
    110405391 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:nmel00536]
    110405391 (FGF1)
Cytokines and growth factors [BR:nmel04052]
 Growth factors
  Growth factors (RTK binding)
   110405391 (FGF1)
Glycosaminoglycan binding proteins [BR:nmel00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110405391 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110405391
NCBI-ProteinID: XP_021266321
LinkDB
Position
12
AA seq 155 aa
MAEGEITTFTALTERFGLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAEDVGEVYIKSTASGQYLAMDTNGLLYGSQLPGEECLFLERLEENHYNTYVSKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagataaccaccttcaccgccctgaccgagcgcttcggcctgccgctg
ggcaactacaagaagcccaagctcctgtactgcagcaacggaggccacttcctacggatc
ctgccggacggcaaggtggacgggacgcgggaccggagtgaccagcacattcagctccag
ctcagtgcggaagacgtgggcgaggtctatataaagagcacagcatcagggcagtacctg
gccatggacaccaacgggctcctgtacggctcgcagctaccgggcgaggagtgcctgttc
cttgagaggctcgaggagaaccattacaacacatatgtctccaaaaagcacgcagataag
aactggttcgtcgggctgaagaagaatgggaacagcaagctggggccgcggactcactat
gggcagaaggcgatcctcttcctcccgctgcccgtgtcagccgactga

DBGET integrated database retrieval system