KEGG   Numida meleagris (helmeted guineafowl): 110406986Help
Entry
110406986         CDS       T06015                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00590  Arachidonic acid metabolism
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110406986 (PTGS1)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110406986 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 110406986
NCBI-ProteinID: XP_021269819
LinkDB All DBs
Position
16
AA seq 606 aa AA seqDB search
MGGGCRARAPPAALRLFLAHAMLLCTAGSAAAAGTVNPCCYYPCQHQGVCVRVGLGGYEC
DCTRTGYFGPNCTSPELWTRLRDLLKPSPAFYHFVLTHFRWFWDIVNSTFIRDTLMRLVL
TVRANLIPSPPTFNSQYGYISWEAYANVSYYTRVLPPVPEECPTPMGTKGKQQLPDAQLL
AQRFLLRHKFEADPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDN
LQRQHQLRLFQDGKLKFQVVNGEVYPPSVTEVPVHMVYLPTIPKEKQLAMGQEVFGLLPG
LCMYTTLWLREHNRVCDILKQEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFL
SLKFDPELLFGQQFQYRNRIAVEFNQLYHWHGLMPDSFTIQGQEYSYEQFLYNTSMLMDY
GVEALVESFSRQTAGRIGGGQNINANVLGVAVGVIEESRQLRLQPFNEYRKRFGLKPYAS
FQELTGEEEKAAELEELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGN
PICSPEYWKPSTFGGATGFEIVKTASLKKLVCLNVKKCPYVAFHVPDATAAGETGSSHAG
GASTEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgggtgccgggcccgggcccccccggccgcgctgcggctttttctcgcccac
gcgatgctgctctgcaccgccgggagcgccgcggccgccggcaccgtcaacccgtgctgc
tattacccctgccagcaccaaggcgtgtgtgtgcgcgttggcctgggaggctacgagtgc
gactgcacgcggacagggtacttcgggcccaactgcacctcacctgagctctggacgcgc
ctacgtgacctgctgaagcccagtcctgccttctaccacttcgtcctcactcacttcagg
tggttctgggacatcgttaacagcacattcatcagagacacactgatgaggctcgtgctc
acagttcgtgccaatctcatccccagccctcccaccttcaactcccagtacggctacatc
agctgggaggcctacgccaatgtcagctattacacccgcgtcctcccgccggtgccggag
gagtgccccacgcccatggggaccaaagggaagcagcagctccccgatgcccagctgctg
gctcagcgcttcctgctgcggcacaagtttgaagctgacccccggggcaccaacttgatg
ttcgccttctttgcccagcatttcacccaccagttcttcaagacctctgggaagatggga
cgcggtttcaccaaggcgctggggcacggggtggacctggggcatctgtatggggacaac
ctgcagcggcagcaccagctgcggctcttccaagatgggaagctcaaattccaggtggtg
aacggggaagtgtacccaccgtcagtcaccgaggtgccagtgcacatggtctacctgccc
accatccccaaggagaagcagctggcgatggggcaggaggtgttcgggctgctgccgggg
ctctgcatgtacaccacgctctggctgcgtgagcacaaccgcgtctgcgacattctgaag
caggagcatcccacctggggtgacgagcagctcttccagacagcacggctcatcctcatc
ggggagaccatcaagatcgtcattgaagactatgtccagcacctcagcgggtacttcctg
agcctcaagttcgaccctgagctgctgttcgggcagcagttccagtaccggaatcgcatc
gcggtggagttcaaccagctctaccactggcacgggctgatgcctgactccttcaccatc
caggggcaggagtacagctacgagcagttcctctacaacacctccatgctcatggactat
ggcgtggaggccctggtggagtccttttccaggcagactgcaggaaggatcggtgggggg
caaaacatcaacgccaacgtcttgggagtggctgttggagtcatcgaggagtcgcggcag
ctgaggctgcagcccttcaatgagtaccggaagaggtttggcctgaagccctatgcatcc
ttccaggaactgacaggagaggaggagaaggcagcagagctggaggagctgtatggagac
attgatgctctggagttttatccagggttgctgcttgagaaaccccaacccaacggcatt
tttggggaaagcatggtggagattggtgccccattttcactgaagggacttcttgggaac
cccatctgctccccggagtactggaagcccagtacctttggtggagcaaccggcttcgag
atcgtcaagacggcatcactgaagaaactcgtgtgcctcaacgtgaagaagtgtccgtac
gtggcgttccatgtgccggatgccacggcagcaggtgagaccggcagcagccatgcgggt
ggagcatccacggagctgtag

DBGET integrated database retrieval system