KEGG   Numida meleagris (helmeted guineafowl): 110407551
Entry
110407551         CDS       T06015                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00220  Arginine biosynthesis
nmel00330  Arginine and proline metabolism
nmel01100  Metabolic pathways
nmel04020  Calcium signaling pathway
nmel04146  Peroxisome
nmel04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110407551 (NOS2)
   00330 Arginine and proline metabolism
    110407551 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110407551 (NOS2)
   04020 Calcium signaling pathway
    110407551 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110407551 (NOS2)
Enzymes [BR:nmel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110407551 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1400
Other DBs
NCBI-GeneID: 110407551
NCBI-ProteinID: XP_021271000
LinkDB
Position
18
AA seq 1136 aa
MLCPWQFAFKPRVVKRQSSEEKDINNNVEKDTKIHRSVKGDAKLHSLSRKQIEMSPTITS
AEKPPQNGIKASSQISRCPRHVKVRNLENGSSLLDTLHLTAKEVINCRTKACQGALMTPK
GLVRGTRDGPVPPAELLPQAIDFVKQYYSSFKELKIEEHLARIETVTKEIETTGTYHLTK
DELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFECICRHIQYATNNGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSVIGDPASVEFTKLCIELGWKPKYGRFD
VVPLILQANGQDPEIFEYPPEIILEVPMEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FTGCPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLASLWKDRAVVEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPMSGSITPVFHQEMLNY
VLTPFFYYQVDAWKTHIWHDETRRPKKREIKLSVLAKAVLFASLLLRKTMAARSKVTVIY
ATETGKSETLANNLCSLFSCAFNTKILCMDEYNISDLEKETLLLVVTSTFGNGDSPNNGK
TLKNSLLTLKLLRKKIRYAVFGLGSTMYPEFCAFAHAIDQKLSQLGAYQLTPVGEGDELN
GQEEAFRTWAVTAFKTACDIFDIRGKNSIQLPEIYTSDDSWNPKKHRIVYDSQTMDLTKA
LADVHAKDIIPMKLKFRQNLQSFKSSRVTILVKLSCETNQEVHYLPGEHIGIFPGNQPEL
VHGLIARVKDAPPADQTIRLETCTEGGYWVSEKKIPACTLSQALTYLLDITTPPSQQLLK
KLSQLVTAEGDKQRLEVLCHSTEEYNKWKFYNSPNILEVLEEFPSAEVTTAFLLTQLPLL
KPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNKIALNETVPCFVRS
ADGFWLPKEPAKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGGDMTLLFGCRQPDMDH
IYKEEVEEMKRRGVLKEVFTAYSRQPGQAKVYVQDILQNKLETKVCNILHKEEGHLYVCG
DVRMARDVAQTLKRILVKNLNLTEQQAEEYFFQLKSQKRYHEDIFGAVLPHEVKRI
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgctgtgcccatggcagtttgcattcaaacctcgtgttgttaagagacagtcctctgaa
gagaaggatatcaataataacgtggagaaagatactaagatccaccgctctgtgaaaggt
gatgccaaattacacagtctaagcaggaagcagatagagatgtcacctacaatcacttca
gcagagaaacccccacaaaatggtatcaaagcttcaagccaaatatcaagatgtccaaga
catgtaaaagtaagaaacttggaaaatggatccagccttctcgacacattacacctgaca
gcaaaggaggttatcaattgtcggaccaaagcttgccaaggagcactcatgaccccaaag
ggcctggtcagaggcactagagatgggccagttcctccagcagagcttctgcctcaggca
atagactttgtcaagcagtactacagttcattcaaagagttaaaaatagaggagcacctg
gcccgaatagaaacggtgaccaaagagatagaaacaacaggaacctaccatctgacaaag
gatgaactgacctttgctgccaaacaggcctggaggaatgctccaagatgtattgggaga
atccagtggtccaatctacaggtatttgatgcacgtgattgtaaaacagccaaggaaatg
tttgaatgtatctgtcgccatattcagtatgccacaaacaatggaaatataagatcagcc
atcaccatcttccctcagaggactgatgggaaacatgatttccgtgtttggaacagccag
ctcatccgatatgctggatatcaaatgccagatgggtctgtcataggagaccctgcaagt
gtggagttcacaaagttgtgcattgagcttgggtggaagccgaaatatggccgctttgat
gtagttccactcattctccaagcaaacggccaggatccagaaatatttgaatacccgcca
gagattatccttgaagtgccaatggagcatccaaaatacgaatggtttaaggagttggac
ctgaagtggtatgctctgcctgctgttgccaacatgctccttgaggtgggaggcctggaa
tttactgggtgtcctttcaatggctggtacatgggaacagagattggagtgcgagacttc
tgtgatgtacagcggtacaacatcttgaaggaggttggaagaagaatgggactggaaacc
aacaaacttgcatcattgtggaaggaccgagctgttgtagagataaatgtggctgtgctt
catagcttccagaaacaaaatgttactatcatggatcaccactcagctgcggagtccttc
atgaaatacatgcagaacgagtaccgcgtgcgaggaggctgcccagctgattgggtgtgg
attgtacctccgatgtcagggagcataactcctgtgttccaccaagagatgttgaactat
gtcctcactcctttcttttactaccaggtggatgcgtggaaaacacatatctggcatgat
gagacccgtaggccaaagaaaagagaaataaaattgagcgtcttggcaaaggctgtactc
tttgcgtcattactcctgcgaaaaacaatggcagccaggtccaaggtgactgtgatctat
gcaacagagactgggaaatcagaaacactagccaacaatctgtgcagcttgttcagctgt
gccttcaacactaagattctgtgcatggatgagtacaacatcagtgacttggaaaaagaa
acacttcttctagtggtgactagcacttttggaaacggagattctccaaataatggaaag
acattgaagaactctttgctcaccctgaaattgctgagaaaaaaaataagatatgctgtg
tttggtttggggtccaccatgtatcctgagttctgtgcctttgctcatgccattgaccaa
aaactgtcccagctgggggcttatcagcttactccagtgggtgaaggagatgaactcaat
ggtcaagaggaagcctttcgcacatgggcggtcactgcattcaagactgcctgtgacatt
tttgacatccgtgggaaaaacagtattcagttgcctgagatatacacatcagatgacagc
tggaatcctaagaaacataggatagtgtatgattctcaaaccatggacttgactaaagca
ttggcagacgttcatgcaaaggatataattcccatgaagctgaaattcagacaaaatctt
cagagtttcaaatccagtcgtgttaccattctagttaagctttcctgtgagactaatcag
gaagtgcactacctgcctggagaacatattgggattttcccaggcaaccagccagaatta
gtccatggcctcattgcacgtgttaaggatgcccctccagctgatcagactatcagactt
gaaacctgtactgaaggtggctactgggtaagcgagaagaagattccagcttgcacactc
tcccaagcgttgacatatttacttgatatcactactccaccctcccaacaacttctaaaa
aagctctcccagctggtaacagcggaaggagacaaacagagactggaagtcttatgtcat
agcacagaagaatacaataaatggaagttttataacagcccaaacatcctggaggtcctg
gaagagtttccttctgctgaagtcacaacagctttcttactgactcagctgccacttctg
aaacccagatactattctgtcagttcctcctgtgatatgacgcccagagagatccatctg
acggttgctgtggtaaactacaggacaagagatggacaagggcctttgcaccatggagtc
tgcagcacatggctgaacaaaatagctctcaatgaaacagtcccatgctttgtgcgcagt
gctgatggattctggcttccaaaggagccagccaagccgtgcattcttattggcccagga
acaggaattgctccattcagaagtttctggcagcagcgtctctatgacttggaaaagaaa
gggatcaaaggtggtgacatgacattactgtttggctgccggcagccagatatggatcat
atctacaaagaagaagttgaagaaatgaagaggagaggagttctgaaggaagtttttaca
gcttactccaggcaacctggccaagctaaagtctatgttcaagatattcttcaaaacaag
ttggaaaccaaagtgtgtaatatcttgcataaagaggaagggcatctgtatgtctgtgga
gatgtgcgcatggccagggatgttgctcagactttgaaaaggatccttgtaaaaaacctg
aacctcacagagcagcaggcagaagagtatttcttccagctaaagagccaaaagcgatac
catgaagatatatttggggctgtgctcccacatgaagtcaaaagaatttaa

DBGET integrated database retrieval system