KEGG   Numida meleagris (helmeted guineafowl): 110407747Help
Entry
110407747         CDS       T06015                                 

Gene name
GALNT17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00512  Mucin type O-glycan biosynthesis
nmel00514  Other types of O-glycan biosynthesis
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110407747 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    110407747 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nmel01003]
    110407747 (GALNT17)
Enzymes [BR:nmel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110407747 (GALNT17)
Glycosyltransferases [BR:nmel01003]
 O-Glycan biosynthesis
  Mucin-type
   110407747 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 110407747
NCBI-ProteinID: XP_021271450
LinkDB All DBs
Position
18
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDVHPRAEVVNLTARGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGH
VTGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CDKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggagagtcaaagtgctgctggtgttaaacttgatcgcggtggctggc
ttcgtcctcttcctggccaagtgcagacccatcacggccaagagcggcgactcctttcat
gacgtccatcccagggcagaagtggtcaacttgacggcccgcggcatcagctccatccag
gacgcggtgctgaagcggctctccctcctggaggacatcgtctacagacagctcaatggt
ctgtccaagtcacttggtctcattgaaggctatggtggacgtggcaaaggggggcttcca
gccaccctgtcccctgaggaggaggagaaagcaaagggaccccatgagaaatacggctac
aactcctacctcagtgagaagatttcactggaccgttccataccagattatcgtccaacc
aagtgcaaagagctgaaatatggcaaggacctgccccagatctccattatcttcatcttc
gtcaacgaggcgctctcggtcatcctgcggtcggtgcacagcgctgtcaatcacacgccg
gcccacctgctgaaggagatcatcctcgtggacgacaacagcgatgaagaggaactgaag
gcgccgctggaggagtacgtcaataagcggtacccagggctcgtgaaagtggtgcgcaac
cagaagagggaaggcctcatccgagcgcgcatcgagggctggaaggcggccacgggccac
gtcaccgggtttttcgatgcccacgtggagttcactgctggctgggccgagccggtgctt
tcacgaattcaggaaaaccgaagaagggtcatcctgccctccatagacaacatcaagcag
gacaacttcgaggtgcagcgttacgagaactcagcccacgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgctggggacccctcgctgcccatc
aggacgccagcgatgatcggttgctcctttgttgtgcacaggaagttctttggagagatt
gggctcctcgatcccgggatggacgtgtacggaggggagaacatagagctcggcatcaag
gtgtggctgtgcggtggcagcatggaagtcctgccctgctctagggtggcccacattgaa
cgcaagaagaagccctacaacaacaacattggtttctacaccaagcgcaacgccctgcga
gtggccgaggtgtggatggacgactacaagtcccatgtctacattgcctggaacttgcca
cttgagaatccaggtattgacatcggggatgtctctgagagaaaagccttaaggaagagc
ttgaagtgtaaaaatttccagtggtatctggaccacgtttatccagaaatgagaagatac
aacaacaccgttgcgtatggcgagcttcgaaacaacaaggcgaaagatgtctgccttgac
cagggcccacaggagaaccacacagcaatattgtacccgtgccatggctggggaccacag
cttgcacgctacaccaaggaggggttccttcaccttggtgcccttgggaccacgacgctc
ctgcccgacacccgctgcctggtggacaacgtgaagagccgcttcccccagctcctcgac
tgcgacaaggtcaagagcagccttcataagcgctggaatttcatccagaacggtgccatc
ctgaacaagggaacagggcgctgcttggaggtggagaacaggggaatggccggcatcgat
ctgatccttcgcagctgcactggacagaggtggacaattaaaaatttcatcaagtaa

DBGET integrated database retrieval system