Numida meleagris (helmeted guineafowl): 110407899 Help Entry 110407899         CDS       T06015                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel04060   Cytokine-cytokine receptor interaction nmel04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:nmel00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110407899  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110407899  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:nmel04052]     110407899    00536 Glycosaminoglycan binding proteins [BR:nmel00536]     110407899 Cytokines and neuropeptides [BR:nmel04052]  Cytokines   Chemokines    110407899 Glycosaminoglycan binding proteins [BR:nmel00536]  Heparan sulfate / Heparin   Chemokines    110407899 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110407899 NCBI-ProteinID:  XP_021271776 LinkDB All DBs Position 18:complement(4869549..4870522) Genome browser AA seq 94 aa AA seqDB search MKGSAAALAALLLLALCSSAVARLCESDGVPTTCCFTYIQDPVPLNLIASAFRSSSKCRL PGVILVTKKGREICANPEESWVQKRLELFQNQEN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagggctccgcagccgccctggccgctctgctcctcctggccctctgctcctcagcc gtggcccgtctgtgtgagtcggatggcgtccccacaacctgctgcttcacctacattcaa gatcccgtcccactcaacctcatcgcctccgccttccgcagcagcagcaagtgccgcctg ccgggggtgatcctggtcaccaagaaggggagggagatatgtgcaaaccccgaggagtcc tgggtgcagaaacgcctggaactcttccagaaccaagaaaactga

DBGET integrated database retrieval system