KEGG   Numida meleagris (helmeted guineafowl): 110408002Help
Entry
110408002         CDS       T06015                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
nmel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    110408002 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 110408002
NCBI-ProteinID: XP_021271977
LinkDB All DBs
Position
19
AA seq 636 aa AA seqDB search
MSSVLETATTPCPIRARHDEMRSAGPAAPNGTTANTRTACSDRHRKWAPLVGGTGSGSGW
AGRAAMLAAGLVLLLAAGLGQGTTRGVLREELLLRPLPVGDVAAVFQFRTRWDADLQQGA
VSHYRLFPKALGQLVAAHGVRELHLTLTQGFWSTQSWGQPSLGAPAGAELWVWFQDTVLD
VDKAWKELSNILSGIFCASLNFIDSTNTVTPTASFKPLGVANGTDHRLLRYAVLPREVVC
TENLTPWKKLLPCGSKAGLAVLLKAERLFHSSYHSQAVHIRPICRDASCLAVSWELRQTL
TVVFDSFTSGQGKKDWSLFKMFSRTLTDACPLASESKVYVDISPKNKEKELLEVTPTPTS
VHEAIVQGDKTTYAVYDLLSPVLFNTSRSLNVQLKWKRPEDSSELSTPILHAQRYVGGYG
LQTGEISTLIYNTHPYRAFPVILLETVPWYLRLYVHTLTIITKGKENKPSYIHYQPAQDR
KRPHLLEMLIQLPANSATKITIQFERALLKWTEYPPDPNHGFYVSSSVLSALVPSVIAMK
DVDVEESPLFTSLFPSSDGSSYFLRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGS
FYNLLTRTFHVEEPSRGGLAKRLANVIRKLRGVPPI
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggtactggagacggcaacaactccctgccctatccgggccaggcacgacgag
atgcgctctgcgggcccagcagcgcccaatggcaccaccgctaacacgcggaccgcctgt
tcggaccgccaccggaagtgggcaccattggtcggcgggaccggaagcggaagtgggtgg
gcgggacgggcggccatgctggcggcggggctggtgctgctgctggcggcggggttgggg
caggggacgacgcggggcgtgctgcgggaggagctgctgctgcggcccctgcccgtgggg
gacgtggccgccgttttccagttccgcacgcgctgggacgccgacctgcagcagggggca
gtctctcactacaggctcttcccgaaggcgctggggcagctggtggcggcacacggcgtg
cgggagctgcatcttaccctcacccagggcttctggagtacccagagctgggggcagccg
tccctgggagcccctgctggtgctgagctctgggtctggttccaggatactgtcctcgat
gttgacaaagcctggaaagaactgagtaacatcctctcgggaatattctgtgcttctctg
aacttcattgactccaccaacacagtcactccaacagcgtccttcaaacccctgggtgta
gccaatgggacagatcaccgtctcctgcgatatgctgtcctgccccgggaggtggtctgc
acagagaacctcacaccttggaagaagctgttgccttgtggctcaaaggctggtctggct
gtgctgctcaaggctgagcggttgtttcacagcagctaccactcgcaggcagtgcacatc
cgccccatctgccgggatgcttcctgcctggctgtttcttgggagctcaggcagaccctc
actgtggtctttgacagctttaccagtggccaaggaaagaaagattggtccctgtttaag
atgttctctcgcacccttactgacgcgtgtcctctggcatcagagagcaaagtctatgtt
gacatctctcctaagaacaaggaaaaagagttgctggaagtgacccccacgccaacatct
gtacacgaagcaattgtccaaggagacaagacaacctatgcagtctatgacctgctcagc
cctgtgctcttcaatacatctcgtagccttaatgtgcagctgaagtggaagcggcctgaa
gacagctcggaactgtcaacacccatactgcacgctcagcgctatgttggtggatacggg
ctgcagaccggagaaatcagcaccctcatctacaacactcacccataccgtgctttccct
gtgatcttgctggagaccgtgccatggtatctacgactttacgtgcacactctgactatc
ataactaagggaaaagaaaacaagccaagttacattcattaccagccagcccaggaccgg
aaacgacctcacctcctggaaatgctgatccagcttccagccaattctgccaccaagatc
acaatccagtttgagagggccttattgaaatggacagagtacccgcctgaccctaatcac
ggcttctacgtcagttcatctgtacttagtgccctggtgcccagtgtcattgcaatgaag
gatgtggatgtggaggagagcccactcttcacctcactgtttccttcctcggatggctcc
agctattttttgcgcctgtacacggagccgctgctggtgaatttgccgacaccagacttc
agcatgccctacaatgtcatttgcctgacgtgcacggtggtggcggtgtgctacggctcc
ttctacaacctgctaactaggacattccacgtggaggagccgagccgtggagggctggcc
aagcggctggccaatgtcatccgcaagctcagaggtgtgccgcccatctga

DBGET integrated database retrieval system