KEGG   Natrialba magadii: Nmag_0441Help
Entry
Nmag_0441         CDS       T01176                                 

Definition
(GenBank) transport protein (probable substrate cationic amino acids)
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Usp Spore_permease Cloacin
Motif
Other DBs
NCBI-ProteinID: ADD04029
UniProt: D3SXY9
LinkDB All DBs
Position
complement(430654..432876)
Genome map
AA seq 740 aa AA seqDB search
MAKDLERDLGLFSVIAISMGAMIGSGIFILPGIAMAEAGPAVILSFVIAAILVVPAALSI
AELGTAMPEAGGDYVFIERGMGPAVGTIAGLGTWLMLMLKGALALVGGMFYLEAVMALPS
IEAVAVTFALILIAVNLIGVKQTGGLQLIMVIVMLLILSVFVAGSIIRVDGANYDPFFTE
GLSGVFTATATVLVSYAGVTKVAAVAEEIENPGRNLPLGLLASLVATSILYALLVFVLVG
VIEGEILAGEEAPMAEAVDVLFGELFLFAIVLAALLALVSTANAGILTASRYPLALSRDN
LFLDVFEYIHPRFATPIVAIVTTGAFMIFAILTLDVEQIAKSAGAFQILVYILVCGALIA
FRERDLEWYDPDFYTPGYPWVQLFGIVSGVFIIGWMDLLPIAGSIGIVIFGYVWYKWYAE
SRVEREGVAKGLARREAGRQFVRDTEEQLEDDDRYEVLIPIRRDVTREQEDALIQLAAPI
VRREGGRIRVIRFDEVPDQVPLDTAAEELTPEDAEFEERTDDLVRYLGIPVEVGEIVSHD
TRHAVVNFAERTGSDLVLARQKPTSRLDTLFGRDTDWIMEHAPCDVVFVQHEQPVELEEI
AIVTDRSPFNDPLKVELADAMADILDARVRFVFTVSEDAPEELEEAIEEYHAELDELCTV
PVDSSILRTNNAIDDLTEELESAQLVMLSTVTHRRLPDLLIEQRSDRIAASVEGPVLLVH
SKKTRRGSFLRPVLDRVLFD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggatctcgaacgtgacctcggtctgttctccgttatcgcgatcagtatgggt
gcgatgatcggcagcggtatcttcatcctgcccggcatcgcgatggccgaagccggtccc
gcggttatcctctcgttcgtgatcgctgcaatcctcgtcgtaccggccgcactgagcatt
gccgaactcggaacggcgatgcctgaagccggcggcgactacgtcttcatcgaacgcgga
atggggcctgctgtgggaactatcgccggcctcggcacctggctcatgttgatgctaaag
ggtgcactcgcgctcgtcggcggcatgttctacctcgaagctgtgatggcgcttccgagt
atcgaggcagttgcggtgacatttgcgctcattctgatcgccgttaacctgatcggtgtc
aagcaaaccggtggtctgcagttgattatggtcatcgtcatgctcctcattctctctgtc
ttcgttgccggctcgatcatccgtgtcgacggcgcgaattacgacccgttcttcaccgag
gggctcagcggtgtgttcactgcaaccgcaacggtgctcgtctcctatgccggcgtcaca
aaggtcgccgccgtcgccgaggaaatcgagaaccccggccgtaaccttccgctcggcctg
ctcgcctcgctcgtcgcgacctcgatcctctacgcgctgctcgtcttcgtcctcgtcggc
gtcatcgagggcgaaatcctcgccggtgaggaagcgccgatggccgaagccgtcgacgtc
ctcttcggggagttgttcctgttcgcgattgtcctcgccgcactgctcgcactcgtcagt
accgcgaacgccggtattctaactgcctctcgctatccgctcgcgctgagccgtgacaat
ctcttcctcgatgtcttcgagtacatccacccgcgctttgcgacgccgatcgtcgccatc
gtcaccacgggcgcgttcatgatcttcgcgatcctcacactcgacgtcgagcagattgcg
aagtccgccggcgcgttccagattctcgtctacatcctcgtctgtggtgcactgatcgcg
ttccgcgagcgcgatctcgagtggtacgaccccgacttctacacgccgggctatccgtgg
gtccagctcttcggtatcgtctccggcgtgttcatcatcggctggatggatctgctgccg
atcgccggctcgatcgggatcgtcatcttcggctacgtctggtacaaatggtacgccgag
tcgcgcgtcgaacgcgaaggtgttgccaagggccttgcccgccgcgaagccggccgtcag
ttcgtccgggacaccgaagaacagctcgaagacgacgaccgatacgaggttctcatcccg
attcgccgtgacgtgaccagagagcaagaagacgcgctgatccagctcgccgcaccgatc
gtccgccgagaggggggtcgaatccgcgtgatccgcttcgacgaagtccccgatcaggtg
ccactcgacaccgccgccgaggagctcactcccgaagacgccgagttcgaggagcgaacc
gacgacctcgtgcgctatctcggtatccccgtcgaagtcggcgaaatcgtcagccacgac
acccgccacgcggtcgtcaacttcgccgagcgcaccggttccgacctcgtactcgcccgg
caaaagccgacgagtcgactcgacacgctcttcggccgcgacaccgactggatcatggaa
cacgcgccgtgtgacgtggtcttcgttcagcacgaacagccggtcgagttagaagagatc
gcgatcgttacggaccgaagcccgttcaacgaccccctcaaggtcgaactcgccgacgcg
atggccgacatcctcgatgcccgcgtccggttcgtctttaccgtctccgaggacgccccc
gaggaactcgaggaggcgatcgaggagtaccacgccgaactcgacgagctctgtaccgtt
cccgtcgactcgtcgattctcagaacgaacaatgcgatcgacgatctgaccgaggaactc
gagtcggctcagctcgtcatgctgagtacggtgacccaccggcggctccccgacctcctc
atcgagcaacgttcggaccggatcgcggcctcggttgaagggccggtgttactggttcac
tcgaagaaaacgcgccgtgggtcgttcctgcggccggttctggatcgggtgctgttcgac
tga

DBGET integrated database retrieval system