KEGG   Natrialba magadii: Nmag_0456Help
Entry
Nmag_0456         CDS       T01176                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nmg  Natrialba magadii
Brite
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Nmag_0456 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: ADD04044
UniProt: D3SY04
LinkDB All DBs
Position
447083..447685
Genome map
AA seq 200 aa AA seqDB search
MTDHELPPLPYDYDALEPSISEQVVTWHHDTHHQGYVNGLNSAEETLAENRESGDFDSTP
GALSNVTHNGCGHYLHTLFWENMSPDGGGEPAGDIADRIEEDFGSYEGWKGEFEAAAGAA
GGWALLVYDPVAKQLRNVAVDKHDQGALWGSHPILALDVWEHSYYYDYGPDRGSFIEGFF
DVINWDSVEDEYQKCLDHFE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccacgaacttccaccacttccatacgattacgacgcactggaaccgtcgatc
tccgagcaggtcgtcacctggcaccacgacacgcaccatcagggctacgtcaacggcctg
aactcggccgaggagaccctcgccgaaaaccgcgagagcggtgacttcgactcgacgccc
ggtgcgctttcgaacgttacccacaacggctgtggccactacctccacacgctgttctgg
gagaacatgtcgccagacggtggcggcgagccagcgggcgacatcgcagaccgtatcgag
gaggacttcggctcctacgagggctggaagggcgaattcgaggccgctgccggcgctgcc
ggtggctgggcgctgctggtatacgacccagttgcgaagcagcttcgcaacgtcgcagtc
gacaagcacgaccagggcgcactctggggctcccacccaatcctcgcactcgacgtctgg
gagcactcctactactacgactacggtccagaccgcggcagcttcatcgagggcttcttc
gacgtgatcaactgggactcggtcgaggacgagtatcagaagtgcctcgaccacttcgag
taa

DBGET integrated database retrieval system