KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1891Help
Entry
NMBH4476_1891     CDS       T01946                                 

Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nmh03021]
    NMBH4476_1891
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nmh02000]
    NMBH4476_1891
Transcription machinery [BR:nmh03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     NMBH4476_1891
Transporters [BR:nmh02000]
 Other Transporters
  Pores ion channels [TC:1]
   NMBH4476_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 Glutaredoxin GST_C_3
Motif
Other DBs
NCBI-ProteinID: ADY96457
UniProt: E6MVC0
LinkDB All DBs
Position
complement(2017359..2017964)
Genome map
AA seq 201 aa AA seqDB search
MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVL
HESNIINEYIDERFPHPQLMPGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAK
AREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWRLDHYDVKLGKSAAPLLKYAE
RIFQREAFIEALTPAEKAMRK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccctctattccggcattacctgccccttcagccaccgctgccgcttcgttttg
tacgaaaaaggtatggattttgaaatcaaagacgtcgatatttacaacaaacccgaagac
ctcgccgtcatgaatccgtataaccaagttcccgtgctggtcgagcgcgatttggtgctg
cacgagtccaatatcatcaacgaatacattgacgaacgcttcccccatccgcagctgatg
cccggcgatcccgttatgcgcggtcggggccggctggtgctgtaccgtatggaaaaagaa
ttgttcaaccacgtccaagtgttagaaaaccccgccgccaccaacaaggaacaggcaaaa
gcgcgcgaagccatcggcaacggtctgaccatgcttgccccttcgttcagcaaaagcaaa
tacatcctcggcgaagatttttctatgattgatgtcgcccttgctccgctgctgtggcgg
ctcgaccactacgatgtcaaactgggcaaaagtgccgcgccgctgctcaaatacgccgag
cgcatcttccagcgcgaagcctttatcgaagcactgacacccgccgaaaaagccatgcgc
aaataa

DBGET integrated database retrieval system