KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0483Help
Entry
NMO_0483          CDS       T00954                                 

Definition
(GenBank) Maf-like protein
  KO
K06287  septum formation protein
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    NMO_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf RAP
Motif
Other DBs
NCBI-ProteinID: CBA04407
UniProt: C6S5L8
LinkDB All DBs
Position
complement(528414..528983)
Genome map
AA seq 189 aa AA seqDB search
MEILTQLGYRVIQLPAGIDESVKADETPACYVQRMAAEKNQTALALFLETNGAMPDFPLI
TADTCVVSDGIILGKPRSQAEAIEFLNRLSGKQHTVLTAVCIHYRGKTSSRVQTNRVVFK
PLSSEEISAYVQSGEPMDKAGAYAVQGIGGIFIQSIEGSFSGIMGLPVYETVSMLQDLGY
RSPLSALKP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctgacacagttgggctaccgcgtcatccaactgcccgccggtatcgacgaa
tccgttaaagccgatgaaacacctgcctgttacgttcaaagaatggcggcagaaaaaaat
cagacggctttggccctgtttctcgaaaccaacggcgcaatgcctgactttcccttgatt
acagcggatacctgcgtcgtttcagacggcatcatattgggcaaaccccgctcccaagct
gaagcaatcgaatttttaaaccgattgtccggcaaacaacataccgtcctgactgctgtc
tgcattcattatcgcggcaaaacgtcaagccgcgtccaaaccaaccgcgtcgttttcaag
cccctgagttcggaagaaatttccgcctatgtgcaaagcggcgaaccgatggacaaagcc
ggcgcctacgccgtacaaggcataggcggcatctttatccaatctatcgaaggcagcttc
agcggcattatgggactgcccgtttatgaaaccgtttcgatgttgcaggatttgggatac
cgctcccccttgtccgcccttaaaccgtaa

DBGET integrated database retrieval system