KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0754Help
Entry
NMO_0754          CDS       T00954                                 

Gene name
dacC
Definition
(GenBank) putative D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00550  Peptidoglycan biosynthesis
nmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMO_0754 (dacC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nmi01002]
    NMO_0754 (dacC)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmi01011]
    NMO_0754 (dacC)
Enzymes [BR:nmi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMO_0754 (dacC)
Peptidases [BR:nmi01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   NMO_0754 (dacC)
Peptidoglycan biosynthesis and degradation proteins [BR:nmi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NMO_0754 (dacC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 DUF5381
Motif
Other DBs
NCBI-ProteinID: CBA05194
UniProt: C6S6C9
LinkDB All DBs
Position
complement(799501..800670)
Genome map
AA seq 389 aa AA seqDB search
MTAHKILPVLLSIILGVSHATAASPAPNRPTVHAAPTLQTPETLTAAHIVIDLQSRQTLS
AKNINTPVEPAALTQLMTAYLVFKNMKSGNIQSEENLKIPESAWASEGSRMFVRPGDTVG
TDKLLKGMIALSANDAALTLAGRLGNGSIENFVQQMNKEARRLGMKNTVFKNPTGLSREG
QVSTAKDLALLSEALMRDFPEYYPLFSIKSFKFKNIEQNNRNILLYRDNNVNGLKAGHTE
SGGYNLAVSYTGNGRHILVITLGSESAEIRASDNSKLLNWALQAFDTPKIYPKGKTVAQI
QISGGSKKTVRAGFLKEAYITLPHKEAKMAEQILETIQPIPAPVKKGQILGKIKIRQNGY
TIAEKEIVALENVKKRSRWQRLWACLTGQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacataaaatcctgcccgtcctactttccatcatcttaggcgtttctcacgca
acggccgcatcgcccgcgcccaacagaccgacggtacacgccgcccccacgctccaaaca
cccgaaaccctcacagcggcacacatcgttatcgaccttcaaagcagacagactttatcc
gccaaaaacatcaatacccctgtcgaaccggcggcactaacccaactgatgaccgcatat
ttagttttcaaaaacatgaaatcgggaaatatccaatctgaagaaaacttaaaaataccc
gaatccgcatgggcttcagaaggaagcagaatgtttgtacgtcccggcgatacggtcggc
accgacaaactcttaaaaggcatgattgccctatccgcaaacgatgccgccctaaccctt
gccggccggctgggcaacggctcgattgaaaattttgtgcaacaaatgaacaaagaagcc
cgacgcttgggcatgaagaacactgtattcaaaaacccgacaggcttgagtagagaagga
caggtttccaccgccaaagacctcgccctgctgtctgaagcattgatgcgcgactttccg
gaatattacccgctgttttccatcaaatctttcaaattcaaaaatatagaacaaaacaac
cgcaatatccttttatatagggacaacaatgtaaacggtctgaaagccggacacacagaa
agcggcggctacaaccttgccgtgtcatacaccggaaacggcaggcatatccttgtcatc
acactaggttcagaatcggcggaaatacgcgcctcagacaacagtaagctgctgaactgg
gcattgcaagccttcgatacgcccaaaatatatccgaaaggcaaaaccgttgcccaaatc
caaatttccggaggcagcaaaaaaaccgtccgcgcaggcttcctcaaagaagcctacatc
actctgccacataaggaagcgaaaatggcagaacagattttggaaaccatacagccgatt
cccgccccagtaaaaaaagggcaaattttaggaaaaatcaaaatcagacaaaacggatac
accattgccgaaaaagaaatcgtcgcactggaaaatgtaaaaaaaagaagccggtggcaa
aggctttgggcgtgtctgacagggcagtaa

DBGET integrated database retrieval system