KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0847Help
Entry
NMO_0847          CDS       T00954                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00020  Citrate cycle (TCA cycle)
nmi00190  Oxidative phosphorylation
nmi00650  Butanoate metabolism
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01200  Carbon metabolism
Module
nmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMO_0847 (sdhA)
   00650 Butanoate metabolism
    NMO_0847 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMO_0847 (sdhA)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMO_0847 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     NMO_0847 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like NAD_binding_8 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CBA05467
UniProt: C6S6M1
LinkDB All DBs
Position
884832..886595
Genome map
AA seq 587 aa AA seqDB search
MGFPVRKFDAVIVGGGGAGLRAALQLSKSGLNCAVLSKVFPTRSHTVAAQGGISASLGNV
QEDRWDWHMYDTVKGSDWLGDQDAIEFMCRAAPEAVIELEHMGMPFDRVESGKIYQRPFG
GHTAEHGKRAVERACAVADRTGHAMLHTLYQQNVRANTQFFVEWTAQDLIRDENGDVVGV
TAMEMETGEVYIFHAKAVMFATGGGGRIYASSTNAYMNTGDGLGICARAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNADGERFMERYAPTVKDLASRDVVSRAMAMEIYEG
RGCGKNKDHVLLKIDHIGAEKIMEKLPGIREISIQFAGIDPIKDPIPVVPTTHYMMGGIP
TNYHGEVVVPQGDEYEVPVKGLYAAGECACASVHGANRLGTNSLLDLVVFGKAAGDSMIK
FIKEQSDWKPLPANAGELTRQRIERLDNQTDGENVDALRRELQRSVQLHAGVFRTDEILS
KGVREVMAIAERVKRTEIKDKSKVWNTARIEALELDNLIEVAKATLVSAEARKESRGAHA
SDDHPERDDENWMKHTLYHSDTNTLSYKPVHTKPLSVEYIKPAKRVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgttcgcaagtttgatgccgtgattgtcggcggtggtggtgcaggttta
cgcgcagccctccaattatccaaatccggtctgaattgtgctgttttgtctaaagtattc
ccaacccgttctcatactgtagcggctcaaggcggtatttctgcttcattgggtaatgtg
caggaagaccgttgggattggcacatgtacgataccgtgaaaggttccgactggttgggc
gaccaagatgcgattgagtttatgtgtcgcgccgcgcctgaagccgtaattgagttggaa
cacatgggtatgccttttgaccgtgtggaaagtggcaaaatctatcaacgtcctttcggc
ggacatactgccgaacacggtaaacgcgcggtagaacgtgcctgtgcggttgccgaccgt
acaggtcatgcgatgctgcatactttgtaccaacaaaacgtccgtgccaatacgcaattc
tttgtggaatggacggcacaagatttgattcgtgatgaaaacggcgatgtcgtcggcgta
accgccatggaaatggaaaccggtgaagtttatattttccacgctaaagctgtgatgttt
gctaccggcggcggcggccgtatttatgcgtcttctaccaatgcctatatgaataccggc
gatggtttgggtatttgtgcgcgtgcaggtatcccgttggaagacatggaattctggcaa
ttccacccgaccggcgtggcaggtgcgggcgtgttgattaccgaaggcgtacgcggcgag
ggcggtattctgttgaatgccgacggcgaacgctttatggaacgctatgcgccgaccgta
aaagacttggcttctcgcgacgttgtttcccgcgcgatggcgatggaaatctacgaaggt
cgcggctgcggtaaaaacaaagaccatgtcttactgaaaatcgaccatatcggcgcagaa
aaaattatggaaaaactgccgggcatccgcgagatttccattcagttcgccggtatcgat
ccgattaaagacccgattcccgttgtgccgactacccactatatgatgggcggcattccg
accaattaccacggcgaagtcgttgtgccgcaaggagacgaatacgaagtgcctgtaaaa
ggcctgtatgccgcaggtgagtgcgcttgtgcttccgtacacggtgcgaaccgcttgggt
acgaactccctgttggacttggtggtattcggtaaagctgccggcgacagcatgattaaa
ttcatcaaagagcaaagcgactggaaacctctgcctgcaaatgccggcgaactgacccgc
caacgtatcgagcgtttggacaatcaaactgatggcgaaaacgttgatgcattgcgtcgc
gaattgcaacgctccgtacaactgcacgccggcgtgttccgtactgatgagattctgagc
aaaggcgttcgagaagtcatggcgattgccgagcgtgtgaaacgtaccgaaatcaaagac
aagagtaaagtgtggaataccgcgcgtatcgaggctttggaattggataacctaattgaa
gtggcgaaagcgactttggtgtctgctgaagcacgtaaagaatcacgcggtgcgcacgct
tcagacgaccatcctgagcgcgatgatgaaaactggatgaaacatacgctgtaccattca
gataccaataccttgtcctacaaaccggtgcacaccaagcctttgagcgtggaatacatc
aaaccggccaagcgcgtttattga

DBGET integrated database retrieval system