KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0848Help
Entry
NMO_0848          CDS       T00954                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00020  Citrate cycle (TCA cycle)
nmi00190  Oxidative phosphorylation
nmi00650  Butanoate metabolism
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01200  Carbon metabolism
Module
nmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMO_0848 (sdhB)
   00650 Butanoate metabolism
    NMO_0848 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NMO_0848 (sdhB)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NMO_0848 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     NMO_0848 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_9 Fer4_7 Fer4_20
Motif
Other DBs
NCBI-ProteinID: CBA05470
UniProt: C6S6M2
LinkDB All DBs
Position
886715..887422
Genome map
AA seq 235 aa AA seqDB search
MEKMSFEIYRYNPDVDAKPYMQRYELELEPTDVKLLDALVRLKAQDDTLSFRRSCREGIC
GSDGMNINGKNGLACLTDLRGLKQPVKIRPLPGLPVIRDLIVDMTQFFKQYHSVKPYVVN
DNPIDADKERLQTQEERKELDGLYECILCACCSTACPSFWWNPDKFVGPSGLLNAYRFIA
DSRDTITNERLDNLNDPYRLFRCHTIMNCVDVCPKHLNPTRAIGKIKEIMLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgagttttgaaatttaccgttacaacccggatgttgatgccaagccttat
atgcagcgttacgagttggaattggaaccgaccgacgtgaaacttttggatgctttggta
cgcctgaaagcacaagacgataccttgtctttccgccgctcctgccgcgaaggcatttgc
ggttctgacggtatgaacatcaacggcaaaaacggcttggcgtgtttgaccgatctgcgt
ggcttgaaacagccggttaaaattcgtcctctgccaggtctgcctgttatccgtgacctg
attgtggatatgacccagttcttcaaacaataccattccgtcaaaccttatgttgtcaac
gataatccgattgatgcggacaaagagcgtctgcaaactcaggaagagcgtaaagagttg
gacggtttgtacgagtgtattttgtgcgcctgctgttcgactgcctgcccgtcattttgg
tggaaccctgataaattcgtcggtccgtccggtttgctgaatgcttaccgtttcattgcg
gacagccgtgataccatcactaatgagcgtttggataatctgaacgacccataccgtttg
ttccgttgccacaccattatgaactgcgtagacgtatgtcctaaacacttgaatccgacc
cgagccatcggtaagattaaagagattatgttgaaacgggccgtttaa

DBGET integrated database retrieval system