KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0852Help
Entry
NMO_0852          CDS       T00954                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00020  Citrate cycle (TCA cycle)
nmi00310  Lysine degradation
nmi00380  Tryptophan metabolism
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01200  Carbon metabolism
Module
nmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMO_0852 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMO_0852 (sucB)
   00380 Tryptophan metabolism
    NMO_0852 (sucB)
Enzymes [BR:nmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMO_0852 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBA05482
UniProt: C6S6M6
LinkDB All DBs
Position
892202..893383
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPAAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgtatcgataccgctgct
actgccgctgctgaagcacctgccgccgctcctgccgaagcagccccggccgccgctcct
gctgccgcgcaaaacaacgccgctatgcctgccgccgccaaactggctgccgaaaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgctgctcctgccgttgcacttcctgccggc
gcgcgtcctgaagaacgcgtaccgatgagccgcctgcgtgcccgtgttgcagaacgcctc
ctggcttcccaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtaaaattg
ggctttatgtccttcttcgttaaagccgctgtcgccgccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgcg
attggcagcccacgcggtttggttgtgccaatcctgcgcgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtacttttggttctatg
atgtctaccccgatcatcaacccgcctcaatctgcgattttgggtatgcatgccactaaa
gagcgcgctgtggttgaaaacggtcaagttgttgtccgtccaatgatgtatctggctctg
tcttacgaccaccgtatcatcgacggtcgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system