KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_1756Help
Entry
NMO_1756          CDS       T00954                                 

Definition
(GenBank) ribonuclease II-related protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmi03016]
    NMO_1756
Enzymes [BR:nmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     NMO_1756
Transfer RNA biogenesis [BR:nmi03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    NMO_1756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: CBA08034
UniProt: C6S918
LinkDB All DBs
Position
1895493..1897373
Genome map
AA seq 626 aa AA seqDB search
MNIFYEESGQFKIAAIIQKNDATYQVDTPHGKRTKVKANNVFAEFDGDMAAFLENAQAQA
ADIDTDLLWEVCGEEEFTAEAIAEEYYGHAPTKTELAATLIALYAAPMYFYKKAKGVFKA
APEETLKQALAAIERKKQQDAQIDAWAEALKRGEMPSEIAADLKTILHAPDKQSLTYKAF
TKAADALKTSAYELAKKTGGITSIPQYLQDGFEIKYFPKGTGFPDLPLPEMPDLPKADVT
AFSIDDESTTEVDDALSLTDLGNGIKRVGIHIAAPSLAIKQGDKMEKNIMERLSTVYFPG
GKITMLPENWIAAFSLDAGTYRPSISIYFDVDNEFNVGAPTCKIEAVNIAENLRIQAIEP
HFNAEAGLDEAGEMMFAHHQDLIWFYQFATALQKARGKYEPDRAPQYDYSIELDKEDNVS
VVRRERGSPIDTLVSEMMILANSTWAQMLHDNDLPGLFRVQPTGKVRMSTKSEPHIGMGV
RHYGWFTSPLRRAADYINQKQLISLIDDTAEPLYQNSDAELFAALRDFDAAYTAYADFQR
QMEAYWSLVYLQQQGTSELTATILKEDLVRIEGLPLVTRATGIPFDALPKSQALFKITEL
DAEKQFVSLNYIKAVAPAGKTAGNAV
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttttacgaagagtccggccaattcaaaatcgccgccatcatccaaaaaaac
gacgctacctaccaagtcgataccccacacggcaaacgcaccaaagtgaaggcgaacaac
gtctttgccgagtttgacggcgatatggcggcgtttttggaaaacgcgcaggcgcaggcg
gcggacatcgacaccgatttattgtgggaagtgtgcggcgaagaggaatttaccgccgaa
gccatagccgaagaatattacggccatgcgccgaccaaaaccgagctggcggcgaccttg
attgcgctgtacgccgcgccgatgtatttctacaaaaaagccaaaggcgtgttcaaagcc
gcgcccgaagaaaccttaaaacaggcgcttgccgccatcgaacgcaaaaagcagcaagac
gcgcaaatcgacgcttgggcggaagccttgaaacgcggcgagatgccgtctgaaatcgcg
gcggatttgaaaaccatcctgcacgcgcccgacaagcagtcgctgacctacaaagccttt
accaaagccgccgacgcgctgaaaacctctgcctacgaattggcgaaaaaaacgggcggc
attacgtccattccccaatacctgcaagacgggtttgaaatcaaatatttccccaaagga
acaggcttccccgaccttccgcttcctgaaatgcctgacttacccaaagccgacgttacc
gccttttccattgacgacgaatcgactaccgaagtggacgacgctttaagcctgaccgat
ttgggcaatggcataaaacgcgtcggcatccacattgccgcgccgtcgcttgccattaag
caaggcgacaaaatggaaaaaaacatcatggaacgcttaagcacggtttattttcccggc
ggcaaaatcactatgttgcccgaaaactggattgccgcgttcagccttgatgcaggtaca
taccgcccttccatcagcatttatttcgatgtggacaacgagttcaacgtcggcgcgccg
acctgcaaaatcgaagcggtcaacatcgctgaaaacctgcgtatccaagccatcgaaccg
catttcaacgccgaagcgggcttggacgaagcgggcgaaatgatgttcgcccaccatcaa
gacctgatttggttttatcaattcgccaccgccctgcaaaaagcgcgcggcaaatacgaa
cccgaccgcgcgccgcaatacgattacagcatcgaattggataaagaagacaacgtatcc
gtcgtccgccgcgaacgcggttcgcccatcgatacgctggtcagcgagatgatgattctt
gccaacagcacttgggcgcaaatgctccatgacaacgacctgcccggcctcttccgcgtc
caacccaccggaaaagtacgcatgagcaccaaatccgagccgcatatcggcatgggcgtg
cggcattacggctggtttacctcgccgctgcgccgcgccgccgactacatcaaccaaaag
cagctgatcagcctgatagacgacactgccgagccgctgtatcaaaacagcgatgccgag
cttttcgccgcactgcgcgactttgatgccgcctataccgcctacgccgacttccaacgc
caaatggaagcctactggagcctggtttacctgcaacagcaaggcacgagcgagctgacg
gcgacgattctgaaagaagacctcgtccgcatcgaaggtctgccgctagtaacacgcgcg
accggtattccgtttgacgcgctgcccaaatcacaggcattgttcaaaatcaccgaatta
gatgccgagaagcagtttgtctcgctcaactacatcaaggcagtcgcacccgcaggcaaa
acggcaggcaatgccgtctga

DBGET integrated database retrieval system