KEGG   Neisseria mucosa ATCC 19696: NM96_02805Help
Entry
NM96_02805        CDS       T05436                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
nmj  Neisseria mucosa ATCC 19696
Pathway
nmj03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    NM96_02805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nmj03400]
    NM96_02805
Enzymes [BR:nmj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     NM96_02805
DNA repair and recombination proteins [BR:nmj03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     NM96_02805
 Prokaryotic type
     NM96_02805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AVR78430
UniProt: A0A2R4ATQ2
LinkDB All DBs
Position
complement(553568..554227)
Genome map
AA seq 219 aa AA seqDB search
MQTWHEAIGSEKSEPYFQHIIETVKKERGMVRIIYPPAEDVFNAFKATEFGNVKVVILGQ
DPYHGAGQAHGLAFSVREGIAVPPSLVNIYKELADDIEGFRIPQHGYLQYWAEQGVLLLN
TVLTVRAGQAHSHATLGWERFTDEVVNQINQNREHVVFMLWGSHAQKKGAFIDRSRHLVL
SAPHPSPLSAYRGFFGCKHFSRANAYLQEKGITPIDWQV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacttggcacgaagcaatcggctcggaaaagtccgaaccctatttccaacacatc
atcgaaaccgtcaaaaaagagcgcggcatggtgcggattatctatccgcctgccgaagac
gtgttcaacgcctttaaagcaaccgaattcggtaacgtcaaagtcgtgattttggggcaa
gacccgtatcacggtgcaggacaggcgcacgggctggcgttttccgtccgcgaaggcatc
gccgtcccgccctcgttggtcaatatttacaaagagttggcggacgacatcgaaggcttc
cgtatcccgcaacacggctatctgcaatattgggcggagcagggcgttttactgctcaat
accgtcctgaccgtccgcgcgggacaggcgcattctcatgcgacattgggttgggagcgc
tttaccgacgaagtggtcaaccaaatcaaccaaaaccgcgaacacgtcgtcttcatgctt
tggggcagtcatgcgcagaaaaaaggcgcgtttatcgaccgcagccgccatctcgtcctc
agcgcgccacacccctcgccgttgtccgcctatcgcggtttcttcggctgcaaacacttt
tcccgcgccaatgcttatttgcaagaaaaaggcataacgccgatagactggcaggtataa

DBGET integrated database retrieval system