KEGG   Neisseria mucosa ATCC 19696: NM96_08205Help
Entry
NM96_08205        CDS       T05436                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nmj  Neisseria mucosa ATCC 19696
Pathway
nmj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NM96_08205
Enzymes [BR:nmj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NM96_08205
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NM96_08205
    1.1.1.-  
     NM96_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N NAD_binding_2 Semialdhyde_dh 2-Hacid_dh_C AdoHcyase_NAD NAD_binding_3 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AVR79314
UniProt: A0A2R4AWC8
LinkDB All DBs
Position
1634847..1635911
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDLKVGQHVVVEPYIIRDDVPTGEGSNYHLSKDMNF
IGLGGCGGGLAEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVLDTMVEACRPTAKVVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELISEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgataaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcaccgtcggcatcaacgtcgcctggtgcggcatctgcggtaccgac
ctgcacgaatttatggaaggtccgattttcatcccgccctgcggccatccgcatccgatt
tccggtgagtccgcgcccgtaacgatgggacacgagttctccggcgtggtttatgccgtc
ggcgaaggcgtggacgacctcaaagtcggacaacacgtcgtggtcgaaccctacatcatc
cgcgatgacgtaccgacaggcgaaggcagcaactaccacctctccaaagacatgaacttc
atcggcttgggcggctgcggcggcggccttgccgaaaaaatcgccgtcaaacgccgctgg
gtgcatccgatttccgacaaaatcccgttagaccaagccgctttgattgaacccctgtcc
gtcggccatcacgcctacgtccgcagcggcgcgaaagcaggcgacgtggcattggtcggc
ggcgcaggcccgatcggtttgctgcttgccgccgtattgaaagccaaaggcatcaaagtc
atcatcaccgaattgagcaaagcgcgcaaagacaaagcccgcgaatccggcgttgccgac
tatatcctcgacccgtctgaagtcgatgtcgtcgaagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtcgcattcgaatgcaccagcgtgaacaaagtactggacaccatggtc
gaagcctgccgcccgaccgcgaaagtcgttatcgtatccatatggagccaccccgccacc
atcaacgtccacagcgtcgtgatgaaagagctggacgtgcgcggcaccatcgcctactgc
aacgaccacgccgaaaccatcaaactggtggaagaaggcaaaatcaaccttgaacctttc
atcacccagcgcatcaagctggacgagctgatttccgaaggcttcgagcgtctgattcac
aacaacgaatctgccgttaaaatcatcgtcaatcccaacctgtaa

DBGET integrated database retrieval system