KEGG   Nakamurella multipartita: Namu_0128Help
Entry
Namu_0128         CDS       T00991                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nml  Nakamurella multipartita
Pathway
nml03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nml00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Namu_0128
Enzymes [BR:nml01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Namu_0128
DNA repair and recombination proteins [BR:nml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Namu_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ACV76562
UniProt: C8XIX5
LinkDB All DBs
Position
143350..145845
Genome map
AA seq 831 aa AA seqDB search
MAADSATVEVDGHRIALTHLRKVLYPASGTTKSEVIAYFAEVAHAMIPHLADRPVTRKRW
PDGVTTAPFFHKDLPKGTPSWVPRRTIRHSDGPKDYPLVDSPATLAWLGQIAALELHVPQ
WTFGSAAASVAGGDGEITEAVFDAVHPNRLVFDLDPGPGVELVDCAHVARAVRERMGGAA
LVPVTSGSKGIHLYAWLDGSLTSDDASAYAREIAEAIEQDMPDLVVSRMAKSLRRGKVFI
DWSQNNGSKTTIAPYSLRGREHPTVAAPRTWEELADPELRHLEYTEVLELLAAAPDPMQG
LEDGDNDGAETRGGSRRRGRGPDTKLDTYRSMRSADKTPEPVPEPGLLPQGDDDTFVIQE
HHARRLHYDFRLERDGVLVSWAVPKGVPESTGRNHLAVHTEDHPMDYADFAGEIPHGEYG
GGTVSIWDRGTYATEKWREDEVIIVLHGGKARGRYALIRTGGKNWLMHRMKDQSPQPKQY
DDHRPATPTAPVTARPAPARSTRPEPPKDLRPMLATAGSVEDVADERRWRFEGKWDGIRA
IATVGPSGLTLRSRLGNDVTPTYPELAVLAELLDGHSAVLDGEIVALQDGRTSFHEMQKR
MNVQRARDVARVMRDVPVQFWIFDVLNLDGISLLDKRYDDRRRILEALPLTGGVCLVPPQ
LAGPARDALRGSADRQWEGIVAKLGDSTYQPGRRSHSWLKIKNFLDLEVVVVGWSPGTGR
REGTVGALLLAVPDGAGGLRYAGKVGTGFTDAILDQLMQALAPLRADRSAVADTIPRADA
AGAIWVRPELVGEVKYGQWTPERRLRATSWRGLRPDKTVADLIAGSAPPPS
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagacagcgcgacggtcgaggtggacggtcaccggatcgcgttgacccatctg
cgcaaggtgctctatccggccagcggcaccaccaaatcggaggtgattgcctacttcgcc
gaggtcgcgcacgcgatgatcccgcacctggccgaccgtccggtgacccgcaaacggtgg
cccgacggggtcaccaccgcgccgttcttccacaaggacctgcccaagggcacgccgagc
tgggtgccgcggcggaccatccggcattccgacgggcccaaggactacccgctggtcgac
tcaccggccacgctggcctggttgggacagatcgccgccctggaactgcatgtgccgcaa
tggacctttgggtccgcggcggcgtcggtggccgggggtgatggtgagatcaccgaggcc
gtcttcgatgccgtgcatccgaaccggttggtgttcgacctcgatccgggaccgggggtc
gagctggtcgactgcgcgcacgtcgcccgggccgtccgcgagcggatgggcggcgcggcg
ctggtcccggtcaccagtggttccaaggggatccatctctacgcctggctggacgggtcg
ctgacctcggacgacgcttcggcctacgcgcgggagatcgccgaggcgatcgagcaggac
atgccggatctggtggtctcccggatggccaagtcgctgcgccgcgggaaggtgttcatc
gactggtcgcagaacaacggctccaagaccaccatcgcgccctactcgttgcgcgggcgg
gagcaccccaccgtggcggccccacggacctgggaggagctggccgaccccgaactgcgg
cacctggagtacaccgaggtgctcgaactgctggccgccgcgccggatcccatgcagggc
ctggaggacggcgacaacgacggcgccgagactcgcggcggctcccggcggcgggggcgc
gggccggacaccaagctggacacctaccgatccatgcggtcggccgacaagaccccggaa
ccggtgcccgagccgggcctgctgccgcagggagacgacgacacgttcgtcatccaggag
catcacgcgcggcgactgcactacgacttccggctcgaacgcgacggggtgctcgtctcc
tgggccgtgccgaagggggtgccggagagcaccggtcgcaatcatctggccgtgcacacc
gaggaccatccgatggactacgccgacttcgccggcgagatcccgcacggcgagtacggc
ggcggcacggtcagcatctgggaccgcggcacctatgccaccgagaaatggcgtgaggac
gaggtcatcatcgtgctgcacggcggcaaggcccgcggccgctacgcgctgatccgcacc
ggtggcaagaactggctgatgcaccggatgaaggaccagagcccccagcccaagcagtac
gacgaccaccgtccggccacgcccaccgccccggtcaccgcccggccggccccggcccgg
tcgacccggcccgagccgccgaaggatctgcggccgatgcttgccaccgccggctcggtc
gaggacgtggccgacgagcggcgctggcggttcgagggcaagtgggacggtatccgggcc
atcgccaccgtcgggccgtcgggattgaccctgcgcagccggctcggcaacgacgtcacc
cccacctatcccgagctggccgtgctggccgagctgctcgacgggcacagcgcggtgctc
gacggtgagatcgtcgccctgcaggacgggcggaccagcttccacgagatgcagaagcgg
atgaacgtgcaacgggccagggacgtggcccgggtgatgcgcgacgtgccggtgcagttc
tggatcttcgacgtgctcaacctggacggcatctccctgctggacaagcgctatgacgat
cgccgccggatcctggaggcgctgccgttgaccggcggggtctgcctggtgccgccgcag
ctggccggtccggcgcgggatgcgctgcgcggcagcgccgaccggcagtgggagggcatc
gtcgccaagctcggcgattcgacctaccagcccggccgccgctcccactcctggctcaag
atcaagaacttcctcgacctggaggtggtggtcgtcggctggtcacccggcaccggtcgc
cgggaggggaccgtgggggcgctgctcctggccgtcccggacggcgccggaggcctgcgc
tacgccggcaaggtgggcaccggcttcaccgatgcgatcctggaccagctgatgcaggcg
ctcgccccgctgcgcgccgaccgctcggccgtcgccgataccatcccgagagccgatgcg
gccggagcgatctgggtccgccccgaactcgtgggcgaggtcaagtacggccagtggacc
cccgagcgccggttgcgcgccaccagctggcgaggcctgcggccggacaagacggtcgcc
gacctcattgccggctccgccccgcccccttcctga

DBGET integrated database retrieval system