KEGG   Nakamurella multipartita: Namu_1281Help
Entry
Namu_1281         CDS       T00991                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nml  Nakamurella multipartita
Pathway
nml00020  Citrate cycle (TCA cycle)
nml00480  Glutathione metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
nml01210  2-Oxocarboxylic acid metabolism
nml01230  Biosynthesis of amino acids
Module
nml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nml_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1281
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Namu_1281
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Namu_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ACV77685
UniProt: C8XDM1
LinkDB All DBs
Position
1403749..1404963
Genome map
AA seq 404 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWQFIKEKLILPYLDVNLEYYDLGIESRDDTNDQITIDA
AHAIQKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIISNIPRL
VPGWTKPIIVGRHAYGDQYRATDFRFPGEGTLTITFTPKDGSKPIEHVVFESPSSGVAQA
MYNLDDSIRDFARASLNYGLSRKYPVYLSTKNTILKAYDGRFKDLFQEVFDAEFIGAFKE
AGITYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGK
TVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTGGLKHRGKLDGTPEVTGFAEALED
VVIKTVEGGKMTKDLALLVGPDQEWLTTEDFLVALDENLATRLG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgagggaacggtcgtcgagctggacggcgacgagatgacccgg
atcatctggcagttcatcaaggagaagctgatcctgccgtacctggacgtgaacctggag
tactacgacctggggatcgagagccgggacgacaccaacgaccagatcaccatcgatgcc
gcgcacgccattcagaagcacggcgtgggcgtcaagtgcgccaccatcaccccggacgag
gcccgggtggaggagttcggcctcaagaagatgtggcgctcgcccaacggcaccatccgc
aacattctcggcggcgtgatcttccgcgagccgatcatcatctccaacatcccccggctg
gtccccggctggaccaagccgatcatcgtgggccgccacgcctacggcgaccagtaccgg
gccaccgacttccggttccccggcgagggcaccctgaccatcaccttcacgcccaaggac
ggctccaagccgatcgagcacgtggtcttcgagtcgcccagttccggtgtcgcgcaggcg
atgtacaacctggacgactcgatccgcgacttcgcccgggcctcgctgaactacggtctg
tcccgcaagtacccggtgtacctgtccaccaagaacacgatcctcaaggcctacgacggc
cggttcaaggacctgttccaggaggtgttcgacgccgagttcatcggggccttcaaggag
gccggcatcacctacgagcaccggctgatcgacgacatggtcgcctccgccctgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtcggacacggtg
gcccagggcttcggctcgctcggcctgatgacctccgtgctgatgaccccggacggcaag
accgtcgaggccgaggccgcgcacggcaccgtcacccggcactaccggcagcaccaggcg
ggcaagccgacctcgaccaacccgatcgcttcgatctacgcctggaccggcggcctcaag
caccgcggcaagctcgacggcacgccggaggtcaccggttttgccgaggccctcgaagat
gtcgtcatcaagaccgtcgagggcggcaagatgaccaaggacctggccctgctcgtcggt
ccggaccaggagtggctgaccaccgaggacttcctggtggccctggacgagaacctggcc
actcgcctgggctga

DBGET integrated database retrieval system