KEGG   Nakamurella multipartita: Namu_3222Help
Entry
Namu_3222         CDS       T00991                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nml  Nakamurella multipartita
Brite
KEGG Orthology (KO) [BR:nml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nml01001]
    Namu_3222
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Namu_3222
Protein kinases [BR:nml01001]
 Serine/threonine kinases: Other
  Bacterial family
   Namu_3222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Kinase-like PBP_N Haspin_kinase LytR_C
Motif
Other DBs
NCBI-ProteinID: ACV79553
UniProt: C8XCV0
LinkDB All DBs
Position
3551371..3553527
Genome map
AA seq 718 aa AA seqDB search
MDVVTGPASGTVLDGRYRLGAMIARGGMSTVYRGLDTRLDRPVAVKVMSPQYVADPTFLS
RFEREARLAASLGHPGVVAMYDQGQDGDLVFLVMELVDGGTLRDLIRERGPLPVPVVLAV
LDPLLDALAAAHAAGLVHRDVKPENVLISARGSVKIADFGLVRAVGSQTVATGDVILGTV
AYLSPEQVATGVSDARTDVYAAGIVAFEMLTGRPPFEGDNPMSVAYQHVHSDVPAPSTRV
DDVPAQLDELIVAATARNPDDRPRDASAFLAELRDVRTALHLPIVPVPIPVRPRPSPTPP
VPVPIDHPAGQTGTRMLPADAASTAYTADTAKTAEGAATTPPTRVQKRPPPVARTRTAAA
RRRRRWLIALLVVLLLGLISAAGGWWLGGRWAATPAAAGLTQSQAEAAVREAGLVPRVTT
GHSDTVPDGVVIGTDPDSGVEQLRGSEVSVLVSAGRPRVPDIKAGTDTATATAALTAADL
TVVTGTGQEFDDAVPVGAVLRTDPVGGTELSVDAPVTLILSAGPRPIVVPQVVGQSQADA
TKSLTDAGFTIGTVTKTFDARVEPGRVLRTDPTVGSTAARGSAVALTVADSITVPDVRGR
STKDAIAAMRDAGFSVTVGDPAFDAGVDAGDILRSDPGPGTRVDRTGASVFLVPSNAVTV
PDLTDQKVKDAERTLADLGLKIDVTSFFGGDNGTVWNQSPAAGGRVRPGDTVSVYVLR
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtggtcaccggtccggcgagcggcaccgtgctcgacggtcgctaccggttgggc
gcgatgatcgcgcgtggcggaatgtccacggtgtaccgcggattggacacccggctggac
cggccggtggccgtgaaggtgatgagcccgcagtatgtcgcggacccgaccttcctgagc
cggttcgaacgcgaggcccggctggccgcctcgctcgggcatcccggggtggtcgccatg
tacgaccagggccaggacggcgacctggtcttcctggtgatggaactggtcgacggcggc
accctgcgcgacctgatccgggaacggggtccgctgccggttccggtggtattggccgtc
ctcgacccgctgctggacgccctggccgcggcgcacgccgccggcctggtgcatcgcgac
gtcaaaccggagaacgtgctgatctcggcccgcgggtcggtcaagatcgccgacttcggc
ctggtccgcgcggtcggctcgcagaccgtggccaccggcgacgtcatcctgggcacggtg
gcgtacctgtcgcccgaacaggtcgccaccggcgtcagcgacgcccggaccgatgtctac
gcggccggcatcgtggcgttcgagatgctcaccggccggccgccgttcgagggcgacaac
ccgatgtcggtggcctaccagcacgtgcattcggacgtgccggccccgtcgacccgggtc
gacgacgtgccggcccagctggacgagctgatcgtggcggccaccgcgcgcaacccggac
gaccggccgcgcgatgccagcgcgttcctggccgagctgcgggacgtgcgcacggccctg
cacctgccgatcgtcccggtaccgatcccggtgcggccccgaccgtcccccaccccaccg
gtcccggtcccgatcgatcacccggccggtcagaccggcacccgcatgctgccggccgac
gcggcgagcacggcatacacggccgacacggctaagacggcagagggtgcggcgaccact
ccgccgacccgcgtgcagaagcgcccaccgcccgtcgcccgcacccgcaccgccgccgcg
cggcgccgtcgccgctggctcatcgcgctgctggtggtgctgctgctgggcctgatctcg
gccgccggcggctggtggctgggcggccgctgggcggccaccccggcggccgcgggactg
acccagtcgcaggccgaggcggccgtgcgcgaggccgggctggtgccccgcgtcaccacc
ggccactcggacaccgtgcccgacggcgtggtcatcggcaccgatcccgattccggggtc
gaacagcttcgcgggtccgaggtgtccgtgctggtctccgccggccgcccgcgggtgccg
gacatcaaggccggcaccgacaccgcgaccgccaccgccgcgctcaccgccgccgacctc
accgtcgtcaccggcaccggtcaggagttcgacgacgcggtcccggtcggcgccgtcctg
cggaccgacccggtcggcgggaccgagctgtccgtggacgcgccggtcaccctgatcctg
tccgccggcccaaggccgatcgtcgtgccccaggtggtcggtcagtcccaggccgacgcg
accaagtcgctgaccgacgccggtttcaccatcgggacggtgaccaagaccttcgacgcc
cgggtcgaacccggccgggtgttgcgcacggaccccacggtgggcagcaccgccgcccgg
ggcagcgcggtggccctgaccgtcgccgactcgatcaccgttccggacgtgcgcggccgg
tcgaccaaggacgcgatcgcggccatgcgcgacgccgggttctcggtcaccgtcggcgat
cccgcgttcgatgccggggtggacgcaggcgacatcctgcgcagcgacccgggaccgggc
acccgggtcgaccgcaccggggcctcggtcttcctggtgccctccaatgcggtcaccgtg
cccgatctgaccgaccagaaggtcaaggacgccgagcgcaccctggccgacctgggcctc
aagatcgacgtgacctcgttcttcggcggcgacaacggaacggtgtggaaccagtcaccg
gcggccggcggacgggtccggccgggtgacacggtcagcgtctacgtgcttcgctga

DBGET integrated database retrieval system