KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0376Help
Entry
NMBM01240149_0376 CDS       T01930                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01130  Biosynthesis of antibiotics
nmm01230  Biosynthesis of amino acids
Module
nmm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM01240149_0376
Enzymes [BR:nmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NMBM01240149_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_17 TsaE AAA AAA_22 PduV-EutP Cytidylate_kin AAA_5
Motif
Other DBs
NCBI-ProteinID: ADY96996
LinkDB All DBs
Position
complement(422046..422558)
Genome map
AA seq 170 aa AA seqDB search
MKNFNGKLILIGLMGAGKTTLGRQMAQRLDYRFYDSDHEIAAAAGVPIPTIFEMEGEQGF
RSRETAILKKLVILPHIVLSTGGGAVLKEENRALIRKSGTVVYLHAPPETLLERTRCDNS
RPLLQVADPLAKLRELYAARDPVYRQTADFTVESANCRETVQTLLKRLSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactttaacggcaaactcatcctcatcggactgatgggcgcgggcaaaaccacg
ctgggccggcaaatggcgcagcggctggattaccgtttttacgacagcgatcacgaaatc
gccgcagccgccggcgttcccatccccaccatatttgaaatggaaggcgaacagggattc
cgttcgcgcgaaaccgccatactcaaaaagctggttatcctgccccatatcgtcctgtcc
accggcggcggcgcggtgttaaaagaagaaaaccgcgcccttatccgcaaaagcggcacg
gtcgtctatctgcacgccccgcccgaaaccctgctcgaacgcacgcgctgcgacaacagc
cgtcctttgctgcaagttgccgatcctttggcgaaattacgtgaactctacgccgcacgc
gaccccgtttaccgccaaaccgccgactttaccgtagaatcggcaaactgccgggaaacc
gtgcaaaccctgctcaaacgcttatcccgataa

DBGET integrated database retrieval system