KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0382Help
Entry
NMBM01240149_0382 CDS       T01930                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00550  Peptidoglycan biosynthesis
nmm01100  Metabolic pathways
nmm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBM01240149_0382
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NMBM01240149_0382
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nmm01003]
    NMBM01240149_0382
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
    NMBM01240149_0382
Enzymes [BR:nmm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NMBM01240149_0382
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBM01240149_0382
Glycosyltransferases [BR:nmm01003]
 Polysaccharide
  Bacterial polysaccharide
   NMBM01240149_0382
Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NMBM01240149_0382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ADY97002
LinkDB All DBs
Position
428928..431324
Genome map
AA seq 798 aa AA seqDB search
MIKKILTTCFGLVFGFCVFGVGLVAIAILVTYPKLPSLDSLQHYQPKMPLTIYSADGEVI
GMYGEQRREFTKIGDFPEVLRNAVIAAEDKRFYRHWGVDVWGVARAAVGNVVSGSVQSGA
STITQQVAKNFYLSSEKTFTRKFNEVLLAYKIEQSLSKDKILELYFNQIYLGQRAYGFAS
AAQIYFNKNVRDLTLAEAAMLAGLPKAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQ
QRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKV
ATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTK
KKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRWAVVQEPL
LQGALVSLDAKTGAVRALVGGYDFHSKTFNRAVQAMRQPGSTFKPFVYSAALSKGMTAST
VVNDAPISLPGKGPNGSVWTPKNSDGRYSGYITLRQALTASKNMVSIRILMSIGVGYAQQ
YIRRFGFRSSELPASLSMALGTGETTPLKVAEAYSVFANGGYRVSSHVIDKIYDRDGRLR
AQMQPLVAGQNAPQAIDPRNAYIMYKIMQDVVRVGTARGAAALGRTDIAGKTGTTNDNKD
AWFVGFNPDVVTAVYIGFDKPKSMGRVGYGGTIAVPVWVDYMRFALKGKQGKGMKMPEGV
VSSNGEYYMKERMVTDPGLTLDNSGIAPQPSRRAKEDDGGAAEGGRQAADDEVRQDMQET
PVLPSNTGSKQQQLDSLF
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagattttaacgacttgttttggtttggtttttgggttttgtgtatttgga
gtgggtttggttgccattgctattttggtaacgtatccgaaactaccgtctttggattct
ttgcagcattaccagcctaaaatgccgttgactatttattcggcggatggggaagtcatc
ggtatgtatggggagcagcggcgcgaatttacaaaaatcggcgatttcccagaggtgttg
cggaatgcggttatcgccgccgaggataaacgcttttaccggcattggggggtggatgtt
tggggtgttgcccgcgctgccgtcggcaatgtcgtgtccggcagcgtgcagtcgggtgcg
agtacgattacgcagcaggtggcgaaaaatttttatttgagcagtgaaaaaacgttcaca
cgcaaattcaatgaggtgttgcttgcctataaaatcgagcagtctttaagcaaagacaaa
atcctcgagttgtatttcaatcagatttacctcggtcagcgcgcctatggttttgcatct
gccgcgcaaatctatttcaataagaatgtccgagatttgactttggcggaagccgccatg
cttgcgggactgcccaaggctccgtctgcctataatccgattgttaatccggaacgtgcc
aagttgcgccagaagtatattttgaacaatatgctcgaggagaagatgattaccgtgcaa
cagcgcgatcaggcgttgaatgaggaactgcattacgagcggtttgttcggaaaatcgat
cagagtgctttatatgtggcggaaatggtgcgtcaggaactgtatgagaaatacggtgaa
gatgcctatacgcagggttttaaggtttataccacggtccgcgccgatcatcagaaggtg
gcaaccgaggcattgcgcaaggctctacggaatttcgatcgcggcagcagctaccgcggt
gcggaaaactatatcgatttgagtaagagtgaagatgtcgaggagactgtcagccagtat
ctgtcgggactctataccgtcgataaaatggttcccgccgttgtgttggatgtgactaaa
aagaaaaatgtcgtcatacagctgcccggcggcaggcgggttacgcttgacaggcgcgcc
ttgggttttgcggcccgcgcggtcaataatgaaaaaatgggggaggaccgtatccgcagg
ggcgcggtcatccgtgtcaaaaacaacggcgggcgttgggcggtggttcaagagccgttg
ctgcagggggctttggtttcgctggatgcaaaaaccggagctgtgcgcgcgctggtcggc
ggttatgattttcacagcaaaacattcaatcgtgccgttcaggcaatgcggcagccgggt
tcgacctttaagccgtttgtctattcggcggcattatctaaggggatgaccgcgtccaca
gtggttaacgatgcgccgatttccctgccggggaaagggccgaacggttcggtttggaca
cctaaaaattcagacggcagatattccggctacattactttgagacaggctctgacggct
tccaagaatatggtttccatccgtattttgatgtctatcggtgtcggttacgcgcaacag
tatatccggcgtttcggcttcaggtcgtccgagctgccggcaagcctgtctatggcttta
ggtacgggcgagacaacgccgttgaaagtggcggaggcatatagcgtatttgcgaacggc
ggatatagggtttcttcgcacgtaatcgataagatttatgacagagacggcaggttgcgc
gcccaaatgcaacctttggtggccgggcaaaatgcgcctcaggcaatcgatccgcgcaat
gcctatattatgtataagattatgcaggatgtggtccgtgttggtacggcaaggggggca
gctgcgttgggaagaacggatattgccggtaaaacgggtacgaccaatgacaataaggat
gcgtggtttgtcggttttaaccctgatgtggttactgccgtatatatcggcttcgacaaa
cctaagagtatggggcgtgtcggctacggcggtacgattgcggtgccggtttgggtggac
tatatgcgttttgcgttgaaaggaaagcagggcaaggggatgaaaatgcctgaaggtgtg
gtcagcagcaatggcgaatactatatgaaggaacgtatggtaaccgatccgggcttgacg
ctggacaacagcggtattgcgccgcaaccttcccgacgggcaaaagaagatgacgggggc
gcggcagaaggcggacggcaggcggcggatgacgaagtccgccaagatatgcaggaaacg
ccggtgcttccgagtaatactggttccaaacagcagcagttggattctctgttttaa

DBGET integrated database retrieval system