KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0391Help
Entry
NMBM01240149_0391 CDS       T01930                                 

Gene name
pbp3
Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBM01240149_0391 (pbp3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nmm01002]
    NMBM01240149_0391 (pbp3)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
    NMBM01240149_0391 (pbp3)
Enzymes [BR:nmm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NMBM01240149_0391 (pbp3)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     NMBM01240149_0391 (pbp3)
Peptidases [BR:nmm01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   NMBM01240149_0391 (pbp3)
Peptidoglycan biosynthesis and degradation proteins [BR:nmm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NMBM01240149_0391 (pbp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ADY97011
LinkDB All DBs
Position
complement(440915..442324)
Genome map
AA seq 469 aa AA seqDB search
MNFPKTAASLLLLLASLAAHALDTGRIPQNEIAVYVQELDSGKVIIDHRSDVPVNPASTM
KLVTAFAAFKTFGSNYRWATEFKSNGTVNDGTLDGNLYWAGSGDPVFNQENLLAVQRQLR
EQGIRNITGHLMLDHSLWGEVGSPDDFEADSGSPFMTPPNPTMLSAGMVMVRAERNAADS
TDILTDPPLSHIFAQNNLKITASQAACPSIKKLMRASFSDNTLKLRGNIPESCLGKPVGV
RMFALDELIRQSFTNHWLLGGGRISDGIGIADTPEGAQTLAVAHAKPMKEILTDMNKRSD
NLIARSVFLKLGGNGKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGLSRKERVTARM
MAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGGLLRLKTGTLNNVRALAGYWLG
DKPMAVVVIINSGRAVSLLPDLDNFVANNIISGGDGWLDAKLMCKERRA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccccaaaacagcggcctccctgctgctgcttctcgcctccctcgccgcacac
gcgctcgatacgggtcgcattccgcaaaacgaaatcgccgtatatgtccaagagcttgac
agcggaaaagtcatcattgaccaccgctcggatgtccccgtcaaccccgcctccacaatg
aaactcgttaccgcgtttgccgccttcaaaaccttcggcagcaattaccgctgggcgacc
gagtttaaaagcaacggtacggtaaacgacggcacgcttgacggaaacctgtattgggcg
ggcagcggcgaccccgttttcaatcaggaaaacctgcttgccgtccaacgccagttgcgc
gaacaaggcatacgcaatatcacgggacacctgatgctcgaccacagcctgtggggcgaa
gtcggcagccccgacgatttcgaagccgacagcggttcgccgtttatgacgccccccaat
ccaactatgctgtctgccggtatggttatggtgcgcgccgaacgcaatgccgccgacagt
accgacatcctcaccgatccgcctttgtcgcatattttcgcccaaaacaacttgaaaatt
accgcctcccaagctgcctgcccttcgatcaaaaaactgatgcgtgcatctttttcggac
aatacgctgaaattgcgcggcaatattcccgagagctgtttgggcaagcctgtcggtgtc
cggatgttcgcgcttgacgaactgatccggcaaagttttaccaaccactggctgctcggc
ggcggacggatttcagacggtatcggcatagccgacacgccggaaggcgcgcagacgctt
gccgttgcacacgccaaaccgatgaaggaaattttgacggacatgaacaagcgttcggac
aatctaattgcgcgttccgtcttcctcaaactcggcggcaacggcaaactgcccgccgtt
tccgaacaggcagcgtctgccgtccggcgtgaacttgccgtgtcgggcatcgatgttgcg
gatttggttttggaaaacggttcaggtctgtctagaaaagaaagggtaacggcgagaatg
atggcgcaaatgttggaaacggcttatttcagcccgtttgcacaagatttcatcgatacg
ctgcccatcgccggcacagacgggactttacgcaaccgcttcaaacaaagcggcgggctg
ttgcgcttaaaaaccggcacgctcaacaatgtccgcgcccttgcaggttattggctgggc
gacaaaccgatggcggtggtcgtcatcatcaacagcggccgcgccgtttccctgctgccc
gacttggacaacttcgttgccaacaacatcatctccggcggcgatggctggctggatgcg
aaactgatgtgcaaagaacgccgagcctga

DBGET integrated database retrieval system