KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1581Help
Entry
NMBM01240149_1581 CDS       T01930                                 

Definition
(GenBank) YihY family protein
  KO
K07058  membrane protein
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nmm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NMBM01240149_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Rrf2 DUF4827
Motif
Other DBs
NCBI-ProteinID: ADY98142
LinkDB All DBs
Position
1723592..1724818
Genome map
AA seq 408 aa AA seqDB search
MTFLQRLQGLADNKICAFAWFVVRRFDEERVPQAAASMTFTTLLALVPVLTVMVAVASIF
PVFDRWSDSFVSFVNQTIVPQGADMVFDYINAFREQANRLTAIGSVMLVVTSLMLIRTID
NTFNRIWRVNSQRPWMMQFLVYWALLTFGPLSLGVGISFMVGSVQDAALASGAPQWSGAL
RTAATLTFMTLLLWGLYRFVPNRFVPARQAFVGALATAFCLETARSLFTWYMGNFDGYRS
IYGAFAAVPFFLLWLNLLWTLVLGGAVLTSSLSYWQGEAFRRGFDSRGRFDDVLKILLLL
DAAQKEGKALPVQEFRRHINMGYDELGELLEKLARYGYIYSGRQGWVLKTGADSIELNEL
FKLFVYRPLPVERDHVNQAVDAVMMPCLQTLNMTLAEFDAQAKKQQQS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacctttttacaacgtttgcaaggtttggcagacaataaaatctgtgcgtttgcatgg
ttcgtcgtccgccgctttgatgaagaacgcgtaccgcaggcggcggcaagcatgacgttt
acgacgctgctggcactcgtccccgtgctgaccgtgatggtggcggtcgcttcgattttc
cccgtgttcgaccgctggtcggattcgttcgtctccttcgtcaaccaaaccattgtgccg
cagggcgcggacatggtgttcgactatatcaatgcgttccgcgagcaggcgaaccggctg
acggcaatcggcagcgtgatgctggtcgttacctcgctgatgctgattcggacgatagac
aatacgttcaaccgcatctggcgggtcaattcccagcgtccgtggatgatgcagtttctc
gtctattgggctttactgacgttcgggccgctgtctttgggcgtgggcatttcctttatg
gtcggctcggtacaggatgccgcgcttgcctcaggtgcgccgcagtggtcgggcgcgttg
cgaacggcggcgacgctgaccttcatgacgcttttgctgtgggggctgtaccgcttcgtg
ccaaaccgcttcgttcccgcgcggcaggcgtttgtcggggctttggcaacagcgttttgt
ctggaaaccgcgcgctccctcttcacttggtatatgggcaatttcgacggctaccgctcg
atttacggcgcgtttgccgccgtgccgttttttctgttgtggctgaacctgttgtggacg
ctggtcttgggcggcgcggtgctgacttcttcactctcctactggcagggagaagcgttc
cgcaggggcttcgactcgcgcggacggtttgacgacgtgttgaaaatcctgctgcttctg
gatgcggcgcaaaaagaaggcaaagccttgcctgttcaggagttcagacggcatatcaat
atgggctacgacgagttgggcgagcttttggaaaagctggcgcggtacggctatatctat
tccggcagacagggttgggtgttgaaaacgggggcggattcgattgagttgaacgaactc
ttcaagctcttcgtttaccgtccgttgcctgtggaaagggatcatgtgaaccaagctgtc
gatgcagtaatgatgccgtgtttgcagactttgaacatgacgctggcagagtttgacgct
caggcgaaaaaacagcagcaatcttga

DBGET integrated database retrieval system